Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1WI90

Protein Details
Accession K1WI90    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
209-237KSAPPKEISAKKSNPKPNKAKGSLKPKKPHydrophilic
NLS Segment(s)
PositionSequence
203-237NKSNKAKSAPPKEISAKKSNPKPNKAKGSLKPKKP
Subcellular Location(s) nucl 14.5, mito 12, cyto_nucl 8
Family & Domain DBs
KEGG mbe:MBM_04917  -  
Amino Acid Sequences MHAYMRACAHIYRGLRFTGEQGYSLTLTLTLTLNPNPNPKSLLTETTLREGDLRESEYLSGYLRDLFGDPRKEPILRGPVSTIKQNRRVTQYKEKTDLRKKSGAYDRNGVIPSIKGMRSDNQESRPLHTAICIAVKEQELKHLESLADDKAAETAKELTIKKVTESLGSSFSSTVNKSNDYLKDKTLNDIIRVIKLAVAKALNKSNKAKSAPPKEISAKKSNPKPNKAKGSLKPKKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.28
4 0.28
5 0.29
6 0.26
7 0.23
8 0.21
9 0.23
10 0.21
11 0.2
12 0.17
13 0.11
14 0.1
15 0.1
16 0.1
17 0.09
18 0.11
19 0.14
20 0.18
21 0.21
22 0.29
23 0.29
24 0.3
25 0.31
26 0.3
27 0.34
28 0.32
29 0.33
30 0.29
31 0.33
32 0.33
33 0.35
34 0.34
35 0.27
36 0.25
37 0.22
38 0.22
39 0.19
40 0.19
41 0.15
42 0.16
43 0.16
44 0.16
45 0.16
46 0.13
47 0.11
48 0.09
49 0.09
50 0.09
51 0.09
52 0.09
53 0.13
54 0.18
55 0.22
56 0.22
57 0.25
58 0.28
59 0.27
60 0.27
61 0.3
62 0.33
63 0.29
64 0.3
65 0.29
66 0.32
67 0.34
68 0.4
69 0.41
70 0.39
71 0.47
72 0.51
73 0.52
74 0.55
75 0.59
76 0.6
77 0.64
78 0.66
79 0.62
80 0.64
81 0.66
82 0.67
83 0.7
84 0.7
85 0.65
86 0.61
87 0.56
88 0.57
89 0.61
90 0.58
91 0.51
92 0.48
93 0.43
94 0.41
95 0.4
96 0.32
97 0.23
98 0.17
99 0.15
100 0.13
101 0.13
102 0.1
103 0.11
104 0.15
105 0.19
106 0.24
107 0.27
108 0.27
109 0.33
110 0.33
111 0.35
112 0.35
113 0.31
114 0.25
115 0.22
116 0.19
117 0.14
118 0.15
119 0.12
120 0.09
121 0.1
122 0.11
123 0.13
124 0.12
125 0.18
126 0.18
127 0.19
128 0.19
129 0.18
130 0.17
131 0.16
132 0.18
133 0.12
134 0.1
135 0.09
136 0.08
137 0.09
138 0.09
139 0.08
140 0.08
141 0.09
142 0.09
143 0.15
144 0.15
145 0.17
146 0.2
147 0.21
148 0.2
149 0.23
150 0.22
151 0.19
152 0.21
153 0.2
154 0.19
155 0.19
156 0.19
157 0.16
158 0.16
159 0.16
160 0.15
161 0.18
162 0.18
163 0.19
164 0.19
165 0.25
166 0.31
167 0.34
168 0.35
169 0.34
170 0.39
171 0.38
172 0.4
173 0.41
174 0.37
175 0.33
176 0.36
177 0.33
178 0.28
179 0.28
180 0.25
181 0.2
182 0.2
183 0.18
184 0.16
185 0.17
186 0.18
187 0.22
188 0.3
189 0.32
190 0.37
191 0.43
192 0.46
193 0.51
194 0.53
195 0.57
196 0.59
197 0.65
198 0.68
199 0.65
200 0.65
201 0.67
202 0.71
203 0.7
204 0.69
205 0.68
206 0.69
207 0.75
208 0.79
209 0.8
210 0.83
211 0.86
212 0.86
213 0.88
214 0.87
215 0.87
216 0.86
217 0.88