Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2PPV7

Protein Details
Accession A0A3N2PPV7    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAPAAGAKKQKKKTHSRIRSKGKVKDKAQHAHydrophilic
NLS Segment(s)
PositionSequence
6-27GAKKQKKKTHSRIRSKGKVKDK
Subcellular Location(s) nucl 19, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGAKKQKKKTHSRIRSKGKVKDKAQHAVILDKTTSEKLHKDVQSYRLVTVATLVDRMKINGSLARSCLKDLEEKGLIKPVVQHSKLKIYSTFLACCRELWDKDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.89
4 0.9
5 0.93
6 0.94
7 0.91
8 0.9
9 0.89
10 0.88
11 0.83
12 0.81
13 0.77
14 0.74
15 0.67
16 0.61
17 0.51
18 0.47
19 0.41
20 0.34
21 0.27
22 0.2
23 0.2
24 0.17
25 0.18
26 0.15
27 0.15
28 0.17
29 0.25
30 0.26
31 0.29
32 0.31
33 0.35
34 0.39
35 0.38
36 0.35
37 0.28
38 0.26
39 0.22
40 0.19
41 0.14
42 0.08
43 0.08
44 0.08
45 0.08
46 0.09
47 0.09
48 0.09
49 0.09
50 0.1
51 0.1
52 0.12
53 0.12
54 0.13
55 0.16
56 0.16
57 0.16
58 0.16
59 0.15
60 0.18
61 0.18
62 0.22
63 0.23
64 0.24
65 0.24
66 0.29
67 0.28
68 0.23
69 0.27
70 0.3
71 0.35
72 0.36
73 0.4
74 0.37
75 0.47
76 0.49
77 0.47
78 0.4
79 0.36
80 0.4
81 0.4
82 0.4
83 0.34
84 0.37
85 0.34
86 0.33
87 0.33
88 0.34
89 0.32