Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PQI1

Protein Details
Accession A0A3N2PQI1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
72-91RNTSKVKRVYQARSNKKSRIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 10, cyto 5.5, pero 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAGLAGYAFFGYFSSIYMSLFMPLFYAGMSQDCLISAFPIKIWTKNTRDENHRRSKPPIPFLLFSSFHCADRNTSKVKRVYQARSNKKSRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.11
5 0.11
6 0.11
7 0.11
8 0.1
9 0.08
10 0.07
11 0.07
12 0.06
13 0.06
14 0.05
15 0.05
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.06
22 0.06
23 0.07
24 0.06
25 0.06
26 0.11
27 0.12
28 0.14
29 0.18
30 0.24
31 0.27
32 0.34
33 0.4
34 0.4
35 0.48
36 0.56
37 0.61
38 0.65
39 0.68
40 0.65
41 0.65
42 0.68
43 0.66
44 0.63
45 0.61
46 0.55
47 0.5
48 0.49
49 0.5
50 0.43
51 0.37
52 0.38
53 0.32
54 0.28
55 0.28
56 0.26
57 0.24
58 0.29
59 0.33
60 0.33
61 0.36
62 0.42
63 0.48
64 0.52
65 0.57
66 0.6
67 0.64
68 0.65
69 0.72
70 0.76
71 0.79