Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PZ21

Protein Details
Accession A0A3N2PZ21    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
179-198SSSRKKETSRSRSRRGRAESHydrophilic
NLS Segment(s)
PositionSequence
170-195KRKAAAEAASSSRKKETSRSRSRRGR
Subcellular Location(s) nucl 20, cyto_nucl 12.5, cyto 3, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039723  Vps71/ZNHIT1  
IPR007529  Znf_HIT  
Gene Ontology GO:0005634  C:nucleus  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF04438  zf-HIT  
Amino Acid Sequences MYSNNFGVIEVANPKTKSAPGWAYVPDVGTNAVTATGLQPSNRKRARNQGPNLSGADLTARQEAKIRKDLEALDRDSNRDANIPIPPRAGSARSLTKSTPNVRKILQSQKTFANHLDDYDALMTLNENNPPPHPNQHTKPKTPHPNQYTKKPPQPNQYTRKAPQPNQYTKRKAAAEAASSSRKKETSRSRSRRGRAESEPDPESEQEPESEATRRDTAASEMQGVEMTGDASAGTTAAAAAAAGPRPVLTPYDGPPPPTHPGDNDPLLVSVVPDLPTDAELRKLLAHPPLSYAQARARWRDEDRQYPARRFCDVCGYWGRVRCMKCGTPVCALDCLELHREECITRYGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.27
4 0.27
5 0.3
6 0.32
7 0.29
8 0.32
9 0.33
10 0.34
11 0.33
12 0.32
13 0.25
14 0.2
15 0.18
16 0.14
17 0.13
18 0.09
19 0.08
20 0.07
21 0.07
22 0.07
23 0.11
24 0.12
25 0.13
26 0.21
27 0.26
28 0.37
29 0.42
30 0.46
31 0.48
32 0.58
33 0.68
34 0.71
35 0.74
36 0.74
37 0.72
38 0.71
39 0.66
40 0.56
41 0.45
42 0.34
43 0.29
44 0.19
45 0.17
46 0.18
47 0.17
48 0.16
49 0.22
50 0.27
51 0.31
52 0.38
53 0.38
54 0.35
55 0.39
56 0.42
57 0.43
58 0.45
59 0.42
60 0.41
61 0.4
62 0.41
63 0.39
64 0.37
65 0.3
66 0.26
67 0.22
68 0.18
69 0.23
70 0.25
71 0.24
72 0.25
73 0.24
74 0.24
75 0.25
76 0.25
77 0.2
78 0.22
79 0.28
80 0.29
81 0.31
82 0.3
83 0.34
84 0.4
85 0.46
86 0.49
87 0.45
88 0.47
89 0.46
90 0.5
91 0.51
92 0.55
93 0.55
94 0.49
95 0.47
96 0.51
97 0.52
98 0.48
99 0.42
100 0.38
101 0.29
102 0.27
103 0.25
104 0.19
105 0.17
106 0.15
107 0.14
108 0.07
109 0.07
110 0.07
111 0.07
112 0.08
113 0.09
114 0.1
115 0.11
116 0.12
117 0.15
118 0.17
119 0.23
120 0.28
121 0.34
122 0.39
123 0.5
124 0.56
125 0.6
126 0.64
127 0.67
128 0.72
129 0.71
130 0.74
131 0.71
132 0.74
133 0.72
134 0.74
135 0.75
136 0.71
137 0.74
138 0.73
139 0.72
140 0.71
141 0.78
142 0.78
143 0.75
144 0.76
145 0.75
146 0.68
147 0.71
148 0.68
149 0.63
150 0.62
151 0.64
152 0.65
153 0.66
154 0.72
155 0.68
156 0.64
157 0.64
158 0.56
159 0.48
160 0.43
161 0.38
162 0.31
163 0.28
164 0.28
165 0.28
166 0.28
167 0.28
168 0.24
169 0.23
170 0.22
171 0.28
172 0.36
173 0.4
174 0.52
175 0.59
176 0.68
177 0.75
178 0.8
179 0.8
180 0.75
181 0.71
182 0.65
183 0.64
184 0.57
185 0.53
186 0.48
187 0.4
188 0.36
189 0.3
190 0.25
191 0.19
192 0.16
193 0.11
194 0.12
195 0.11
196 0.11
197 0.13
198 0.13
199 0.14
200 0.14
201 0.14
202 0.14
203 0.14
204 0.15
205 0.17
206 0.16
207 0.15
208 0.14
209 0.14
210 0.13
211 0.12
212 0.09
213 0.06
214 0.05
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.03
222 0.03
223 0.03
224 0.02
225 0.02
226 0.02
227 0.03
228 0.04
229 0.04
230 0.04
231 0.05
232 0.05
233 0.06
234 0.07
235 0.08
236 0.09
237 0.12
238 0.14
239 0.23
240 0.23
241 0.25
242 0.26
243 0.3
244 0.32
245 0.32
246 0.31
247 0.25
248 0.3
249 0.33
250 0.33
251 0.29
252 0.25
253 0.22
254 0.21
255 0.18
256 0.14
257 0.09
258 0.09
259 0.09
260 0.08
261 0.08
262 0.08
263 0.09
264 0.11
265 0.11
266 0.12
267 0.12
268 0.13
269 0.14
270 0.15
271 0.17
272 0.22
273 0.24
274 0.21
275 0.25
276 0.27
277 0.29
278 0.28
279 0.29
280 0.28
281 0.33
282 0.37
283 0.39
284 0.41
285 0.44
286 0.48
287 0.55
288 0.57
289 0.59
290 0.62
291 0.67
292 0.7
293 0.71
294 0.73
295 0.67
296 0.65
297 0.57
298 0.52
299 0.52
300 0.46
301 0.43
302 0.42
303 0.44
304 0.44
305 0.48
306 0.51
307 0.47
308 0.48
309 0.48
310 0.49
311 0.46
312 0.5
313 0.51
314 0.51
315 0.52
316 0.53
317 0.5
318 0.47
319 0.44
320 0.36
321 0.3
322 0.29
323 0.26
324 0.24
325 0.22
326 0.2
327 0.2
328 0.19
329 0.2