Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PZE0

Protein Details
Accession A0A3N2PZE0   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-40DDVGLRKKKEKGEERRKKRKEEKKEGKREERKEKEKEYEBasic
NLS Segment(s)
PositionSequence
7-37RKKKEKGEERRKKRKEEKKEGKREERKEKEK
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MDDVGLRKKKEKGEERRKKRKEEKKEGKREERKEKEKEYEGTAIATAKTIPRLRPVPFVPEPVESVLMSLISGERIGRDQWVPRGEEPQLGVSDSSDARIRRNVDAFPGRMRCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.9
4 0.91
5 0.92
6 0.92
7 0.91
8 0.91
9 0.91
10 0.92
11 0.91
12 0.95
13 0.94
14 0.94
15 0.94
16 0.92
17 0.92
18 0.91
19 0.88
20 0.85
21 0.82
22 0.78
23 0.74
24 0.66
25 0.59
26 0.52
27 0.43
28 0.36
29 0.29
30 0.22
31 0.16
32 0.14
33 0.1
34 0.07
35 0.12
36 0.14
37 0.14
38 0.19
39 0.22
40 0.24
41 0.29
42 0.29
43 0.32
44 0.3
45 0.33
46 0.29
47 0.26
48 0.26
49 0.21
50 0.21
51 0.13
52 0.12
53 0.09
54 0.07
55 0.06
56 0.05
57 0.04
58 0.03
59 0.04
60 0.04
61 0.04
62 0.05
63 0.06
64 0.08
65 0.1
66 0.13
67 0.19
68 0.22
69 0.25
70 0.25
71 0.29
72 0.27
73 0.28
74 0.26
75 0.23
76 0.2
77 0.18
78 0.17
79 0.14
80 0.15
81 0.13
82 0.14
83 0.15
84 0.15
85 0.17
86 0.23
87 0.26
88 0.29
89 0.33
90 0.32
91 0.36
92 0.43
93 0.43
94 0.45