Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2Q0C6

Protein Details
Accession A0A3N2Q0C6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
88-111QEESQYPKRTRKIERRIERKISGMHydrophilic
NLS Segment(s)
PositionSequence
96-107RTRKIERRIERK
Subcellular Location(s) mito 10, plas 4, nucl 3, cyto 3, extr 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MSSIHLCFASPASAGASVAFVLIRVLASISRCVRIPRFEDDVDPFAPLILLYSTSKQRVMALVSSTDRVCIRNSEIESDGGRLLTLQQEESQYPKRTRKIERRIERKISGMTHHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.08
5 0.07
6 0.07
7 0.05
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.05
14 0.07
15 0.12
16 0.14
17 0.15
18 0.16
19 0.19
20 0.22
21 0.26
22 0.28
23 0.29
24 0.32
25 0.32
26 0.33
27 0.33
28 0.33
29 0.28
30 0.25
31 0.2
32 0.14
33 0.13
34 0.1
35 0.07
36 0.04
37 0.06
38 0.06
39 0.08
40 0.1
41 0.12
42 0.12
43 0.12
44 0.12
45 0.12
46 0.12
47 0.12
48 0.11
49 0.12
50 0.12
51 0.13
52 0.13
53 0.13
54 0.12
55 0.12
56 0.12
57 0.12
58 0.14
59 0.18
60 0.19
61 0.21
62 0.21
63 0.22
64 0.22
65 0.21
66 0.19
67 0.13
68 0.12
69 0.09
70 0.08
71 0.1
72 0.1
73 0.09
74 0.11
75 0.13
76 0.14
77 0.2
78 0.27
79 0.31
80 0.37
81 0.44
82 0.5
83 0.56
84 0.66
85 0.72
86 0.75
87 0.79
88 0.83
89 0.85
90 0.88
91 0.89
92 0.82
93 0.76
94 0.71
95 0.64