Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PQJ6

Protein Details
Accession A0A3N2PQJ6   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-40GMRKNGKQWHEPKKAFRPKABasic
76-120RTQALREKRAKKEEKERYEKMAEKMHRKRVERLKRKEKRNKLLNSBasic
NLS Segment(s)
PositionSequence
23-44RKNGKQWHEPKKAFRPKAGLTS
46-116EQRAKEREAMAAAKAKEKQMKDEKEALRQQRTQALREKRAKKEEKERYEKMAEKMHRKRVERLKRKEKRNK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSVTEEATPSQAPAATKTPLGMRKNGKQWHEPKKAFRPKAGLTSYEQRAKEREAMAAAKAKEKQMKDEKEALRQQRTQALREKRAKKEEKERYEKMAEKMHRKRVERLKRKEKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.18
4 0.19
5 0.25
6 0.31
7 0.33
8 0.36
9 0.4
10 0.46
11 0.55
12 0.61
13 0.59
14 0.6
15 0.67
16 0.71
17 0.74
18 0.71
19 0.71
20 0.75
21 0.81
22 0.75
23 0.7
24 0.66
25 0.59
26 0.62
27 0.55
28 0.47
29 0.4
30 0.44
31 0.44
32 0.43
33 0.41
34 0.33
35 0.33
36 0.33
37 0.33
38 0.27
39 0.23
40 0.19
41 0.19
42 0.19
43 0.22
44 0.2
45 0.19
46 0.19
47 0.21
48 0.23
49 0.23
50 0.29
51 0.34
52 0.37
53 0.39
54 0.46
55 0.46
56 0.49
57 0.56
58 0.54
59 0.51
60 0.49
61 0.46
62 0.45
63 0.45
64 0.41
65 0.44
66 0.46
67 0.5
68 0.57
69 0.64
70 0.65
71 0.73
72 0.77
73 0.76
74 0.78
75 0.8
76 0.8
77 0.81
78 0.76
79 0.73
80 0.72
81 0.7
82 0.63
83 0.62
84 0.59
85 0.61
86 0.66
87 0.69
88 0.7
89 0.69
90 0.74
91 0.76
92 0.8
93 0.8
94 0.82
95 0.83
96 0.85
97 0.92
98 0.93
99 0.93
100 0.93