Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2Q8F8

Protein Details
Accession A0A3N2Q8F8   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
121-142LVLRCKKERWDHKEKTRKREGQBasic
NLS Segment(s)
Subcellular Location(s) cyto 9, cyto_nucl 9, nucl 7, pero 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045200  CHIP  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
IPR003613  Ubox_domain  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0061630  F:ubiquitin protein ligase activity  
GO:0000209  P:protein polyubiquitination  
Pfam View protein in Pfam  
PF04564  U-box  
PROSITE View protein in PROSITE  
PS51698  U_BOX  
Amino Acid Sequences MSEAKALQLKAEGNRCFQQGDYVGAEGFYSKAIIANPKNAIFYTNRANARLKLQLWDAAISDCHEALALAEKNMKAEFYLSQALLPLGDYDGAVQAAMRAHRLCVESGERERASLSAITALVLRCKKERWDHKEKTRKREGQYFEEEMVGLLSREKAKAVEGAEGEGEKRELASEWDAKISELRNVFEKSRAKDEQRREVPDWAIDDISFGIMVDPVITKTGKSYERASIMEHLHRHPSDPLTREPLVPSELRPNLALKQACEEFLDENGWAVDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.41
3 0.39
4 0.35
5 0.34
6 0.28
7 0.29
8 0.26
9 0.23
10 0.22
11 0.2
12 0.2
13 0.14
14 0.12
15 0.08
16 0.06
17 0.05
18 0.07
19 0.09
20 0.18
21 0.2
22 0.26
23 0.3
24 0.31
25 0.32
26 0.3
27 0.31
28 0.26
29 0.27
30 0.29
31 0.33
32 0.34
33 0.35
34 0.39
35 0.38
36 0.4
37 0.43
38 0.36
39 0.32
40 0.31
41 0.32
42 0.3
43 0.28
44 0.24
45 0.18
46 0.18
47 0.16
48 0.15
49 0.11
50 0.1
51 0.08
52 0.07
53 0.07
54 0.13
55 0.12
56 0.12
57 0.15
58 0.15
59 0.17
60 0.17
61 0.17
62 0.1
63 0.11
64 0.11
65 0.11
66 0.14
67 0.13
68 0.13
69 0.13
70 0.13
71 0.11
72 0.11
73 0.07
74 0.05
75 0.05
76 0.05
77 0.04
78 0.05
79 0.05
80 0.05
81 0.04
82 0.05
83 0.06
84 0.07
85 0.08
86 0.08
87 0.08
88 0.11
89 0.13
90 0.12
91 0.13
92 0.16
93 0.18
94 0.21
95 0.26
96 0.23
97 0.22
98 0.22
99 0.19
100 0.18
101 0.14
102 0.12
103 0.08
104 0.08
105 0.08
106 0.09
107 0.09
108 0.11
109 0.12
110 0.13
111 0.13
112 0.15
113 0.2
114 0.28
115 0.38
116 0.43
117 0.52
118 0.6
119 0.69
120 0.78
121 0.8
122 0.81
123 0.81
124 0.79
125 0.73
126 0.73
127 0.67
128 0.63
129 0.62
130 0.55
131 0.45
132 0.38
133 0.34
134 0.25
135 0.2
136 0.13
137 0.07
138 0.05
139 0.05
140 0.06
141 0.06
142 0.07
143 0.07
144 0.08
145 0.11
146 0.11
147 0.13
148 0.12
149 0.13
150 0.12
151 0.12
152 0.12
153 0.09
154 0.08
155 0.05
156 0.05
157 0.05
158 0.05
159 0.07
160 0.11
161 0.13
162 0.14
163 0.15
164 0.15
165 0.15
166 0.17
167 0.16
168 0.16
169 0.15
170 0.15
171 0.18
172 0.21
173 0.22
174 0.27
175 0.32
176 0.31
177 0.37
178 0.42
179 0.45
180 0.51
181 0.58
182 0.61
183 0.63
184 0.67
185 0.62
186 0.61
187 0.55
188 0.5
189 0.44
190 0.34
191 0.27
192 0.2
193 0.17
194 0.13
195 0.11
196 0.08
197 0.06
198 0.05
199 0.04
200 0.04
201 0.04
202 0.05
203 0.05
204 0.07
205 0.07
206 0.07
207 0.09
208 0.16
209 0.18
210 0.21
211 0.24
212 0.28
213 0.32
214 0.33
215 0.34
216 0.34
217 0.35
218 0.38
219 0.38
220 0.35
221 0.39
222 0.38
223 0.38
224 0.36
225 0.38
226 0.39
227 0.39
228 0.42
229 0.41
230 0.42
231 0.41
232 0.39
233 0.35
234 0.32
235 0.29
236 0.27
237 0.3
238 0.31
239 0.31
240 0.3
241 0.3
242 0.3
243 0.36
244 0.36
245 0.28
246 0.33
247 0.32
248 0.32
249 0.3
250 0.29
251 0.23
252 0.22
253 0.22
254 0.15
255 0.15