Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PNL6

Protein Details
Accession A0A3N2PNL6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-43TEHILGRDRKAKKKKRRKKKLSSSSLVGKBasic
NLS Segment(s)
PositionSequence
21-34RDRKAKKKKRRKKK
Subcellular Location(s) mito 10, plas 6, extr 5, E.R. 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRIPLQSTIAAAAQTEHILGRDRKAKKKKRRKKKLSSSSLVGKPVLLLFFVFFFLLLISAAISVLSLAAYFPGILCNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.07
4 0.08
5 0.13
6 0.14
7 0.18
8 0.25
9 0.32
10 0.42
11 0.52
12 0.62
13 0.68
14 0.79
15 0.85
16 0.88
17 0.93
18 0.94
19 0.95
20 0.95
21 0.95
22 0.93
23 0.88
24 0.81
25 0.77
26 0.69
27 0.59
28 0.47
29 0.36
30 0.26
31 0.22
32 0.17
33 0.09
34 0.06
35 0.05
36 0.05
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.04
57 0.04
58 0.04