Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2PY74

Protein Details
Accession A0A3N2PY74    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
16-36WLKPTNRPSRQTPPHRSPRGAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
Amino Acid Sequences MRILIRGRHQAGLVPWLKPTNRPSRQTPPHRSPRGAYKATLPPSPTPHHHAPNPSSPTPPAIPDNGIRLLALDGGGVRGLSSLMILRSLMTAVDPDNFPKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.3
4 0.3
5 0.32
6 0.38
7 0.4
8 0.46
9 0.51
10 0.56
11 0.62
12 0.72
13 0.77
14 0.79
15 0.78
16 0.8
17 0.81
18 0.76
19 0.68
20 0.68
21 0.66
22 0.59
23 0.49
24 0.45
25 0.46
26 0.46
27 0.45
28 0.37
29 0.31
30 0.33
31 0.36
32 0.33
33 0.32
34 0.34
35 0.36
36 0.36
37 0.38
38 0.37
39 0.41
40 0.44
41 0.38
42 0.35
43 0.31
44 0.32
45 0.28
46 0.27
47 0.21
48 0.16
49 0.17
50 0.17
51 0.2
52 0.18
53 0.17
54 0.15
55 0.13
56 0.12
57 0.1
58 0.09
59 0.06
60 0.04
61 0.05
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.06
72 0.06
73 0.07
74 0.07
75 0.07
76 0.07
77 0.06
78 0.07
79 0.07
80 0.11
81 0.11