Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2Q5C3

Protein Details
Accession A0A3N2Q5C3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
37-58RALHSNPKRNHRKNVRIPKVTTHydrophilic
NLS Segment(s)
PositionSequence
48-49RK
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MNRQELLPTVSISALERFQLVVEMSQDSCGRDQCVPRALHSNPKRNHRKNVRIPKVTTNQRPHRPPKVPYPFSSACLRTTGGNRPSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.1
5 0.1
6 0.11
7 0.1
8 0.09
9 0.09
10 0.1
11 0.1
12 0.12
13 0.13
14 0.12
15 0.13
16 0.13
17 0.14
18 0.15
19 0.17
20 0.18
21 0.25
22 0.25
23 0.25
24 0.3
25 0.29
26 0.37
27 0.43
28 0.49
29 0.46
30 0.56
31 0.65
32 0.65
33 0.74
34 0.74
35 0.77
36 0.79
37 0.85
38 0.85
39 0.81
40 0.78
41 0.77
42 0.76
43 0.74
44 0.73
45 0.71
46 0.71
47 0.73
48 0.79
49 0.78
50 0.79
51 0.77
52 0.72
53 0.73
54 0.75
55 0.71
56 0.65
57 0.66
58 0.58
59 0.55
60 0.57
61 0.48
62 0.38
63 0.35
64 0.33
65 0.28
66 0.3
67 0.37