Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PZW6

Protein Details
Accession A0A3N2PZW6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
92-122TIPDCEKGPCRWRRRRRRRRMQIMSSPGGRRBasic
NLS Segment(s)
PositionSequence
102-112RWRRRRRRRRM
Subcellular Location(s) extr 10, plas 6, E.R. 3, vacu 3, cyto 2, mito 1, cyto_nucl 1, pero 1, golg 1
Family & Domain DBs
Amino Acid Sequences MQLRGFISYLVLFLLAAIPLARAADNRYIVTLVEGVDIDAYIGKICAEGDVEELDRWTTSPYGVLVRSHSHTVVSLAAYDEVVSVEEDRTITIPDCEKGPCRWRRRRRRRRMQIMSSPGGRRLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.05
4 0.05
5 0.04
6 0.05
7 0.05
8 0.06
9 0.06
10 0.09
11 0.14
12 0.16
13 0.16
14 0.17
15 0.17
16 0.16
17 0.17
18 0.14
19 0.09
20 0.08
21 0.08
22 0.07
23 0.06
24 0.06
25 0.05
26 0.04
27 0.04
28 0.03
29 0.04
30 0.03
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.05
37 0.06
38 0.07
39 0.07
40 0.07
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.05
47 0.06
48 0.06
49 0.08
50 0.09
51 0.09
52 0.1
53 0.12
54 0.14
55 0.15
56 0.14
57 0.12
58 0.12
59 0.12
60 0.11
61 0.09
62 0.08
63 0.07
64 0.07
65 0.07
66 0.06
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.07
77 0.08
78 0.08
79 0.1
80 0.11
81 0.12
82 0.13
83 0.15
84 0.18
85 0.23
86 0.33
87 0.4
88 0.49
89 0.6
90 0.69
91 0.79
92 0.87
93 0.92
94 0.94
95 0.96
96 0.97
97 0.97
98 0.97
99 0.96
100 0.95
101 0.92
102 0.87
103 0.83
104 0.74