Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2Q1U4

Protein Details
Accession A0A3N2Q1U4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
46-98EGNRHYRVYTHRRRNIRRKRERQRERETERERERERREREREEKIKKRKETTPBasic
NLS Segment(s)
PositionSequence
56-94HRRRNIRRKRERQRERETERERERERREREREEKIKKRK
Subcellular Location(s) nucl 16.5, cyto_nucl 9.833, mito 8.5, cyto_mito 5.833
Family & Domain DBs
Amino Acid Sequences MSGRPFLRVFQTSGYPGIERKKNPAITPDKTSLLPKAEVKPNWYREGNRHYRVYTHRRRNIRRKRERQRERETERERERERREREREEKIKKRKETTPGTIWKYIRSGIVCICVCVRDQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.24
3 0.25
4 0.31
5 0.34
6 0.32
7 0.37
8 0.44
9 0.47
10 0.47
11 0.53
12 0.53
13 0.51
14 0.56
15 0.52
16 0.46
17 0.43
18 0.43
19 0.37
20 0.32
21 0.3
22 0.28
23 0.3
24 0.35
25 0.35
26 0.39
27 0.43
28 0.44
29 0.47
30 0.46
31 0.42
32 0.42
33 0.5
34 0.54
35 0.5
36 0.49
37 0.44
38 0.46
39 0.52
40 0.55
41 0.55
42 0.57
43 0.6
44 0.66
45 0.76
46 0.82
47 0.85
48 0.86
49 0.87
50 0.87
51 0.91
52 0.93
53 0.94
54 0.93
55 0.92
56 0.91
57 0.87
58 0.87
59 0.82
60 0.8
61 0.77
62 0.75
63 0.7
64 0.69
65 0.7
66 0.69
67 0.71
68 0.72
69 0.73
70 0.74
71 0.76
72 0.78
73 0.79
74 0.8
75 0.82
76 0.83
77 0.84
78 0.82
79 0.82
80 0.78
81 0.78
82 0.76
83 0.74
84 0.73
85 0.72
86 0.71
87 0.71
88 0.65
89 0.58
90 0.52
91 0.45
92 0.4
93 0.32
94 0.29
95 0.24
96 0.32
97 0.28
98 0.28
99 0.27
100 0.23