Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PYJ6

Protein Details
Accession A0A3N2PYJ6   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
73-111SSNRAVDKKKPPGIKRKRKRKRKRKRKRKRKRKRKRRDRBasic
NLS Segment(s)
PositionSequence
79-111DKKKPPGIKRKRKRKRKRKRKRKRKRKRKRRDR
Subcellular Location(s) nucl 11.5, mito 10.5, cyto_nucl 8.333, cyto_mito 7.833, cyto 4
Family & Domain DBs
Amino Acid Sequences MGSISAGFFLWSFWGYITGSVTGHDWLIFGLSAYLDFDEDIMAVTSYDIFFANLFEYMRYITRPFSVLNFRVSSNRAVDKKKPPGIKRKRKRKRKRKRKRKRKRKRKRRDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.12
5 0.11
6 0.11
7 0.11
8 0.12
9 0.1
10 0.1
11 0.09
12 0.07
13 0.06
14 0.07
15 0.06
16 0.05
17 0.05
18 0.04
19 0.04
20 0.05
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.05
35 0.04
36 0.04
37 0.04
38 0.05
39 0.05
40 0.05
41 0.06
42 0.05
43 0.05
44 0.06
45 0.07
46 0.07
47 0.08
48 0.08
49 0.09
50 0.1
51 0.1
52 0.13
53 0.18
54 0.19
55 0.22
56 0.22
57 0.22
58 0.24
59 0.25
60 0.25
61 0.22
62 0.28
63 0.29
64 0.33
65 0.39
66 0.47
67 0.55
68 0.59
69 0.64
70 0.65
71 0.72
72 0.78
73 0.82
74 0.84
75 0.86
76 0.89
77 0.92
78 0.95
79 0.96
80 0.96
81 0.96
82 0.97
83 0.97
84 0.97
85 0.98
86 0.98
87 0.98
88 0.98
89 0.98
90 0.98
91 0.98