Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1XIK0

Protein Details
Accession K1XIK0    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
203-224DFDPEEYKREKERRKDKSANEVAcidic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 15, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
KEGG mbe:MBM_09615  -  
Pfam View protein in Pfam  
PF13637  Ank_4  
Amino Acid Sequences MAKDLRAHPEQDQEHEGASIGEVLIEAARRNNTDLLKETIDSIGDEDKAAKILNETKTVLGNHIYHEAALRGNYEVIDMLLDQPGFECDPLTRIDGDTPLHSAIRYLNSLTESSPLTPAVTTFSQELIGMMIEAGSDPRLKNKANLTPYQLVDPRNEKLRQQLQDAVDVTQNQGDYIEDERNDARDFGVGGEGDDVGSASDSDFDPEEYKREKERRKDKSANEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.28
4 0.18
5 0.16
6 0.11
7 0.07
8 0.06
9 0.05
10 0.05
11 0.06
12 0.06
13 0.07
14 0.1
15 0.12
16 0.13
17 0.16
18 0.21
19 0.22
20 0.25
21 0.28
22 0.29
23 0.29
24 0.28
25 0.27
26 0.23
27 0.21
28 0.18
29 0.15
30 0.13
31 0.11
32 0.11
33 0.1
34 0.1
35 0.1
36 0.1
37 0.09
38 0.1
39 0.16
40 0.19
41 0.21
42 0.22
43 0.22
44 0.25
45 0.26
46 0.24
47 0.22
48 0.19
49 0.18
50 0.19
51 0.18
52 0.15
53 0.15
54 0.14
55 0.11
56 0.11
57 0.1
58 0.08
59 0.08
60 0.08
61 0.08
62 0.07
63 0.06
64 0.06
65 0.05
66 0.05
67 0.06
68 0.06
69 0.05
70 0.05
71 0.07
72 0.07
73 0.06
74 0.06
75 0.05
76 0.07
77 0.08
78 0.09
79 0.08
80 0.08
81 0.09
82 0.1
83 0.11
84 0.1
85 0.11
86 0.1
87 0.1
88 0.09
89 0.09
90 0.09
91 0.1
92 0.1
93 0.09
94 0.09
95 0.1
96 0.11
97 0.1
98 0.1
99 0.09
100 0.09
101 0.09
102 0.09
103 0.08
104 0.07
105 0.07
106 0.09
107 0.08
108 0.09
109 0.09
110 0.09
111 0.09
112 0.09
113 0.09
114 0.06
115 0.06
116 0.04
117 0.04
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.05
124 0.05
125 0.09
126 0.13
127 0.14
128 0.18
129 0.24
130 0.31
131 0.35
132 0.38
133 0.41
134 0.42
135 0.42
136 0.42
137 0.39
138 0.33
139 0.32
140 0.33
141 0.29
142 0.32
143 0.33
144 0.29
145 0.35
146 0.42
147 0.41
148 0.42
149 0.45
150 0.4
151 0.43
152 0.43
153 0.35
154 0.29
155 0.26
156 0.23
157 0.18
158 0.16
159 0.11
160 0.1
161 0.09
162 0.09
163 0.11
164 0.14
165 0.12
166 0.15
167 0.16
168 0.18
169 0.18
170 0.17
171 0.15
172 0.12
173 0.13
174 0.11
175 0.13
176 0.1
177 0.1
178 0.1
179 0.1
180 0.08
181 0.08
182 0.07
183 0.05
184 0.05
185 0.05
186 0.04
187 0.06
188 0.06
189 0.08
190 0.09
191 0.1
192 0.12
193 0.13
194 0.19
195 0.22
196 0.26
197 0.34
198 0.43
199 0.52
200 0.6
201 0.7
202 0.75
203 0.81
204 0.87