Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PVD7

Protein Details
Accession A0A3N2PVD7   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-71TTAPETRKSNKKSREPPPSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013923  Autophagy-rel_prot_16_dom  
Gene Ontology GO:0043170  P:macromolecule metabolic process  
GO:0006807  P:nitrogen compound metabolic process  
GO:0044238  P:primary metabolic process  
Pfam View protein in Pfam  
PF08614  ATG16  
CDD cd22887  Atg16_CCD  
Amino Acid Sequences MPGWRDEYLASLREQERNNPVNLELVDLCSQLADRIAALEAEKDVLAARAATTAPETRKSNKKSREPPPSTEDTTSDPAIAQLRLDLAESLRSRGALQTRLKKAEDEVADLRAKNRSDARRVKELSADRAVLITKLRDREDEIREKRKLIENVQDEMIALNLHVAMAEKERDKVKKENAELVDRWMKRMAQEAEAMNLANEPHFERKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.42
4 0.44
5 0.45
6 0.4
7 0.38
8 0.36
9 0.34
10 0.31
11 0.22
12 0.21
13 0.2
14 0.18
15 0.18
16 0.13
17 0.13
18 0.09
19 0.1
20 0.07
21 0.06
22 0.06
23 0.07
24 0.07
25 0.07
26 0.08
27 0.07
28 0.08
29 0.07
30 0.07
31 0.06
32 0.07
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.09
40 0.13
41 0.15
42 0.2
43 0.23
44 0.29
45 0.38
46 0.45
47 0.52
48 0.58
49 0.66
50 0.7
51 0.77
52 0.82
53 0.78
54 0.77
55 0.73
56 0.7
57 0.63
58 0.55
59 0.47
60 0.4
61 0.37
62 0.32
63 0.25
64 0.19
65 0.16
66 0.16
67 0.14
68 0.1
69 0.07
70 0.07
71 0.07
72 0.07
73 0.06
74 0.05
75 0.1
76 0.1
77 0.12
78 0.11
79 0.12
80 0.12
81 0.14
82 0.16
83 0.18
84 0.24
85 0.31
86 0.35
87 0.38
88 0.38
89 0.36
90 0.34
91 0.33
92 0.28
93 0.23
94 0.2
95 0.2
96 0.21
97 0.21
98 0.21
99 0.19
100 0.19
101 0.17
102 0.23
103 0.25
104 0.33
105 0.41
106 0.45
107 0.5
108 0.51
109 0.5
110 0.5
111 0.48
112 0.44
113 0.39
114 0.34
115 0.25
116 0.24
117 0.23
118 0.17
119 0.15
120 0.12
121 0.13
122 0.16
123 0.17
124 0.18
125 0.23
126 0.28
127 0.34
128 0.42
129 0.47
130 0.51
131 0.52
132 0.52
133 0.51
134 0.53
135 0.51
136 0.46
137 0.48
138 0.43
139 0.44
140 0.44
141 0.4
142 0.31
143 0.26
144 0.21
145 0.12
146 0.07
147 0.05
148 0.04
149 0.04
150 0.04
151 0.04
152 0.05
153 0.07
154 0.11
155 0.12
156 0.15
157 0.21
158 0.26
159 0.3
160 0.37
161 0.44
162 0.51
163 0.54
164 0.59
165 0.58
166 0.61
167 0.57
168 0.56
169 0.56
170 0.47
171 0.45
172 0.4
173 0.36
174 0.31
175 0.39
176 0.35
177 0.29
178 0.33
179 0.32
180 0.31
181 0.31
182 0.29
183 0.2
184 0.18
185 0.15
186 0.11
187 0.11
188 0.13