Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2Q746

Protein Details
Accession A0A3N2Q746    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-84FTLRCVHPPRQQRKQKHKRHKSEHKGMKGRTBasic
NLS Segment(s)
PositionSequence
63-82RQQRKQKHKRHKSEHKGMKG
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MLLMLCLSSYFLINESVCGATEKRRHSHPEVDGVAPKESALVVRMSALPPYKPFTLRCVHPPRQQRKQKHKRHKSEHKGMKGRTEDCSVAILGAAPCSLTCPLQRCCSFSVLVTVHCSLFSTALSMSKDARWSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.12
5 0.14
6 0.14
7 0.18
8 0.25
9 0.3
10 0.33
11 0.38
12 0.45
13 0.49
14 0.56
15 0.52
16 0.55
17 0.52
18 0.51
19 0.49
20 0.44
21 0.39
22 0.3
23 0.26
24 0.17
25 0.14
26 0.11
27 0.09
28 0.07
29 0.06
30 0.07
31 0.08
32 0.08
33 0.11
34 0.11
35 0.11
36 0.13
37 0.16
38 0.17
39 0.19
40 0.2
41 0.22
42 0.25
43 0.26
44 0.34
45 0.39
46 0.44
47 0.49
48 0.58
49 0.62
50 0.68
51 0.75
52 0.76
53 0.79
54 0.83
55 0.87
56 0.88
57 0.9
58 0.91
59 0.92
60 0.93
61 0.92
62 0.92
63 0.91
64 0.89
65 0.86
66 0.77
67 0.74
68 0.68
69 0.59
70 0.51
71 0.46
72 0.36
73 0.29
74 0.28
75 0.2
76 0.15
77 0.13
78 0.11
79 0.07
80 0.07
81 0.06
82 0.05
83 0.05
84 0.06
85 0.07
86 0.08
87 0.11
88 0.16
89 0.2
90 0.28
91 0.3
92 0.31
93 0.33
94 0.34
95 0.32
96 0.27
97 0.31
98 0.24
99 0.24
100 0.25
101 0.23
102 0.21
103 0.2
104 0.21
105 0.14
106 0.14
107 0.12
108 0.1
109 0.1
110 0.14
111 0.16
112 0.16
113 0.17
114 0.19