Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2PTC6

Protein Details
Accession A0A3N2PTC6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
56-86KETTNNRKYKEKRQSKEREYIKKKRIEEKEEBasic
NLS Segment(s)
PositionSequence
36-48GNMKGRAGRRRTR
62-90RKYKEKRQSKEREYIKKKRIEEKEEGEKK
Subcellular Location(s) nucl 6, cyto 6, cyto_nucl 6, mito 4, cyto_pero 4
Family & Domain DBs
Amino Acid Sequences MSSTLLFLLFLCSGLIHSSLDLRFRRYGQRCTRWKGNMKGRAGRRRTRSRYLCFQKETTNNRKYKEKRQSKEREYIKKKRIEEKEEGEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.07
4 0.07
5 0.1
6 0.11
7 0.18
8 0.19
9 0.22
10 0.23
11 0.26
12 0.35
13 0.38
14 0.47
15 0.51
16 0.6
17 0.63
18 0.68
19 0.74
20 0.72
21 0.75
22 0.74
23 0.74
24 0.72
25 0.69
26 0.69
27 0.7
28 0.71
29 0.69
30 0.67
31 0.66
32 0.69
33 0.7
34 0.73
35 0.72
36 0.69
37 0.73
38 0.75
39 0.73
40 0.66
41 0.62
42 0.59
43 0.59
44 0.62
45 0.61
46 0.61
47 0.58
48 0.58
49 0.66
50 0.65
51 0.68
52 0.7
53 0.71
54 0.71
55 0.78
56 0.85
57 0.83
58 0.87
59 0.86
60 0.86
61 0.85
62 0.86
63 0.84
64 0.82
65 0.81
66 0.81
67 0.81
68 0.78
69 0.77
70 0.76