Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2Q1D3

Protein Details
Accession A0A3N2Q1D3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-87GSLGTKKTREVWPKRRYHNPISPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, mito 6, cyto 2, extr 2, E.R. 2, golg 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIPLRAAFYSAFFFSFCGHYPPPTSDMNAIRLITAAFFVSFVLFDGRGRYPKFYTLIKRFGREFGSLGTKKTREVWPKRRYHNPISP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.14
4 0.17
5 0.17
6 0.18
7 0.21
8 0.23
9 0.25
10 0.24
11 0.25
12 0.24
13 0.26
14 0.27
15 0.27
16 0.24
17 0.2
18 0.19
19 0.17
20 0.12
21 0.1
22 0.07
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.05
30 0.05
31 0.05
32 0.07
33 0.09
34 0.13
35 0.14
36 0.16
37 0.17
38 0.2
39 0.23
40 0.26
41 0.34
42 0.36
43 0.45
44 0.45
45 0.47
46 0.45
47 0.46
48 0.44
49 0.36
50 0.31
51 0.25
52 0.31
53 0.29
54 0.3
55 0.34
56 0.31
57 0.31
58 0.36
59 0.41
60 0.42
61 0.52
62 0.6
63 0.64
64 0.73
65 0.8
66 0.86
67 0.85