FuNGI

A0A3N2PMW7

Protein Details

Accession

A0A3N2PMW7

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
422-443	AESSRQVKGKPRRQSNVTLAEK	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 11, mito 6, extr 4, E.R. 4, cyto_mito 4

Family & Domain DBs

InterPro	View protein in InterPro IPR002076 ELO_fam
Gene Ontology	GO:0016020 C:membrane GO:0009922 F:fatty acid elongase activity GO:0102756 F:very-long-chain 3-ketoacyl-CoA synthase activity GO:0006633 P:fatty acid biosynthetic process
Pfam	View protein in Pfam PF01151 ELO

Amino Acid Sequences

MFFTMPSGATIIGGLPSSALFSVPTGQEPLGVPPPAPGSSSTTFAIPDHIYTAVLDARVPITIATLYAVTVKLLNRYNTSNGKKPWAISKTAPFKAFVILHNLFLAVYSAWTFWGMLGGMRRTVVSPMGPHGLAATADSLCQVNGPPGFGYATVHSDTLGQWTSFSGPAPLGSDGAPSREVYGRLWNEGLAFYGWIFYLSKFYEVLDTFVILAKGKLSSTLQTYHHAGAMMCMWAGMRYMSAPIWIFVLVNSFIHALMYTYYTLTAFNVRVPTPIKRSLTTMQIMQFVLGASFAMLHSFISYTIPMVVPVENAAKAAAASSPAAGAVVTTTLGALDSLRQLITGGLDAAVASPVPTAESVAAAAAAAASSSSSQTETIFVTQPCITTSGETFAIWLNVFYLAPLTYLFVMFFIRSYLRRSSAESSRQVKGKPRRQSNVTLAEKAGWDAARDVNREIYHNGSEEGGLAEKTNGKARY

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.07
2	0.06
3	0.06
4	0.07
5	0.07
6	0.07
7	0.06
8	0.07
9	0.12
10	0.12
11	0.14
12	0.15
13	0.15
14	0.17
15	0.18
16	0.22
17	0.24
18	0.23
19	0.22
20	0.21
21	0.25
22	0.23
23	0.23
24	0.2
25	0.21
26	0.23
27	0.26
28	0.25
29	0.22
30	0.22
31	0.21
32	0.24
33	0.18
34	0.17
35	0.15
36	0.15
37	0.14
38	0.13
39	0.15
40	0.13
41	0.12
42	0.11
43	0.1
44	0.1
45	0.1
46	0.1
47	0.08
48	0.08
49	0.07
50	0.08
51	0.08
52	0.07
53	0.07
54	0.09
55	0.09
56	0.08
57	0.1
58	0.11
59	0.16
60	0.21
61	0.24
62	0.25
63	0.29
64	0.35
65	0.42
66	0.48
67	0.5
68	0.49
69	0.53
70	0.52
71	0.51
72	0.54
73	0.48
74	0.47
75	0.45
76	0.51
77	0.53
78	0.56
79	0.55
80	0.47
81	0.43
82	0.44
83	0.4
84	0.32
85	0.31
86	0.27
87	0.26
88	0.25
89	0.24
90	0.18
91	0.16
92	0.15
93	0.07
94	0.06
95	0.06
96	0.06
97	0.06
98	0.07
99	0.07
100	0.06
101	0.07
102	0.07
103	0.08
104	0.11
105	0.12
106	0.12
107	0.12
108	0.13
109	0.12
110	0.13
111	0.13
112	0.11
113	0.11
114	0.13
115	0.16
116	0.16
117	0.15
118	0.14
119	0.13
120	0.11
121	0.1
122	0.09
123	0.06
124	0.06
125	0.07
126	0.07
127	0.06
128	0.07
129	0.06
130	0.09
131	0.09
132	0.1
133	0.09
134	0.1
135	0.11
136	0.1
137	0.12
138	0.09
139	0.12
140	0.12
141	0.12
142	0.11
143	0.11
144	0.11
145	0.13
146	0.13
147	0.1
148	0.09
149	0.1
150	0.11
151	0.11
152	0.11
153	0.09
154	0.08
155	0.08
156	0.1
157	0.1
158	0.09
159	0.08
160	0.1
161	0.1
162	0.11
163	0.11
164	0.1
165	0.11
166	0.13
167	0.13
168	0.13
169	0.2
170	0.2
171	0.2
172	0.21
173	0.19
174	0.17
175	0.16
176	0.16
177	0.08
178	0.07
179	0.05
180	0.06
181	0.05
182	0.06
183	0.06
184	0.05
185	0.08
186	0.09
187	0.1
188	0.09
189	0.1
190	0.12
191	0.12
192	0.13
193	0.1
194	0.1
195	0.1
196	0.1
197	0.11
198	0.07
199	0.07
200	0.06
201	0.06
202	0.06
203	0.07
204	0.07
205	0.08
206	0.1
207	0.14
208	0.15
209	0.17
210	0.2
211	0.19
212	0.19
213	0.18
214	0.16
215	0.12
216	0.11
217	0.09
218	0.06
219	0.06
220	0.05
221	0.04
222	0.04
223	0.04
224	0.03
225	0.03
226	0.04
227	0.04
228	0.06
229	0.06
230	0.06
231	0.06
232	0.06
233	0.06
234	0.05
235	0.07
236	0.06
237	0.06
238	0.06
239	0.06
240	0.06
241	0.06
242	0.06
243	0.04
244	0.05
245	0.06
246	0.06
247	0.05
248	0.06
249	0.06
250	0.06
251	0.06
252	0.08
253	0.07
254	0.09
255	0.11
256	0.11
257	0.13
258	0.16
259	0.19
260	0.22
261	0.28
262	0.29
263	0.27
264	0.32
265	0.32
266	0.34
267	0.32
268	0.3
269	0.25
270	0.25
271	0.24
272	0.2
273	0.17
274	0.12
275	0.11
276	0.08
277	0.06
278	0.03
279	0.04
280	0.03
281	0.03
282	0.03
283	0.03
284	0.04
285	0.04
286	0.05
287	0.05
288	0.05
289	0.05
290	0.06
291	0.06
292	0.06
293	0.07
294	0.07
295	0.06
296	0.08
297	0.09
298	0.08
299	0.08
300	0.08
301	0.07
302	0.06
303	0.07
304	0.05
305	0.05
306	0.05
307	0.05
308	0.05
309	0.05
310	0.05
311	0.04
312	0.04
313	0.03
314	0.03
315	0.03
316	0.03
317	0.03
318	0.03
319	0.03
320	0.04
321	0.04
322	0.04
323	0.05
324	0.06
325	0.06
326	0.06
327	0.06
328	0.07
329	0.07
330	0.06
331	0.06
332	0.05
333	0.05
334	0.05
335	0.05
336	0.05
337	0.04
338	0.04
339	0.03
340	0.03
341	0.04
342	0.04
343	0.05
344	0.05
345	0.05
346	0.05
347	0.05
348	0.05
349	0.04
350	0.04
351	0.03
352	0.03
353	0.02
354	0.02
355	0.03
356	0.03
357	0.04
358	0.05
359	0.06
360	0.07
361	0.07
362	0.09
363	0.1
364	0.12
365	0.16
366	0.16
367	0.18
368	0.19
369	0.19
370	0.18
371	0.19
372	0.17
373	0.14
374	0.15
375	0.15
376	0.15
377	0.14
378	0.14
379	0.13
380	0.14
381	0.12
382	0.11
383	0.09
384	0.09
385	0.09
386	0.08
387	0.08
388	0.07
389	0.07
390	0.08
391	0.08
392	0.08
393	0.08
394	0.08
395	0.08
396	0.09
397	0.08
398	0.08
399	0.09
400	0.12
401	0.13
402	0.18
403	0.22
404	0.25
405	0.27
406	0.32
407	0.37
408	0.43
409	0.5
410	0.54
411	0.54
412	0.56
413	0.59
414	0.58
415	0.62
416	0.64
417	0.65
418	0.66
419	0.72
420	0.75
421	0.76
422	0.81
423	0.8
424	0.8
425	0.76
426	0.69
427	0.59
428	0.52
429	0.47
430	0.38
431	0.33
432	0.22
433	0.17
434	0.17
435	0.22
436	0.25
437	0.27
438	0.28
439	0.31
440	0.32
441	0.34
442	0.34
443	0.33
444	0.3
445	0.3
446	0.29
447	0.23
448	0.22
449	0.19
450	0.18
451	0.14
452	0.12
453	0.11
454	0.13
455	0.16
456	0.18

A0A3N2PMW7

3D AlphaFold-predicted Structure Viewer