Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2PWM1

Protein Details
Accession A0A3N2PWM1    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-35ERNRMAASKCRKKKKEWVSELQETKHydrophilic
NLS Segment(s)
PositionSequence
20-25CRKKKK
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences DDHPKRQKVLERNRMAASKCRKKKKEWVSELQETKTGLENQHLQLQREYNGLLDEVSRMKNELISHAHCNDPNIDQWLDNEAKRFVQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.62
3 0.6
4 0.6
5 0.6
6 0.62
7 0.68
8 0.69
9 0.72
10 0.8
11 0.82
12 0.82
13 0.8
14 0.8
15 0.78
16 0.81
17 0.77
18 0.68
19 0.59
20 0.48
21 0.4
22 0.33
23 0.27
24 0.18
25 0.17
26 0.19
27 0.18
28 0.25
29 0.25
30 0.23
31 0.23
32 0.23
33 0.22
34 0.19
35 0.18
36 0.11
37 0.1
38 0.09
39 0.08
40 0.07
41 0.07
42 0.08
43 0.09
44 0.08
45 0.09
46 0.09
47 0.12
48 0.12
49 0.15
50 0.18
51 0.22
52 0.26
53 0.27
54 0.3
55 0.28
56 0.29
57 0.27
58 0.24
59 0.23
60 0.23
61 0.22
62 0.19
63 0.2
64 0.24
65 0.25
66 0.24
67 0.25
68 0.22