Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PWH8

Protein Details
Accession A0A3N2PWH8    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
6-26LDPQRHYKKDSLKPRIPRYAHBasic
76-95KSSGKKAFYKKLVAHRRRRNBasic
NLS Segment(s)
PositionSequence
78-95SGKKAFYKKLVAHRRRRN
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences MRGTALDPQRHYKKDSLKPRIPRYAHIGRIIEGPTEFYSSRLTRRERKRTLVQEIMAAEAASTKFKSKYENIGAQKSSGKKAFYKKLVAHRRRRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.7
4 0.7
5 0.77
6 0.82
7 0.84
8 0.76
9 0.7
10 0.68
11 0.66
12 0.62
13 0.58
14 0.5
15 0.4
16 0.41
17 0.38
18 0.3
19 0.21
20 0.19
21 0.14
22 0.15
23 0.14
24 0.12
25 0.16
26 0.16
27 0.21
28 0.24
29 0.29
30 0.35
31 0.45
32 0.55
33 0.56
34 0.62
35 0.67
36 0.68
37 0.7
38 0.65
39 0.56
40 0.48
41 0.43
42 0.37
43 0.28
44 0.2
45 0.13
46 0.09
47 0.09
48 0.07
49 0.08
50 0.09
51 0.1
52 0.12
53 0.17
54 0.19
55 0.28
56 0.34
57 0.42
58 0.45
59 0.5
60 0.5
61 0.47
62 0.5
63 0.44
64 0.43
65 0.38
66 0.36
67 0.36
68 0.45
69 0.53
70 0.53
71 0.59
72 0.59
73 0.67
74 0.75
75 0.79