Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2Q605

Protein Details
Accession A0A3N2Q605    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VAAKKHVPIVKKRTKRFFRHQSDRFKCVDPSWRKPKGIDSRVRRRFRSHydrophilic
NLS Segment(s)
PositionSequence
12-17KKRTKR
35-38KPKG
42-45RVRR
Subcellular Location(s) mito 22.5, mito_nucl 12.833, cyto_nucl 2.833, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKRTKRFFRHQSDRFKCVDPSWRKPKGIDSRVRRRFRSAISMPSIGYGSNKKTKYMMPSGHKAFLVNNVNDVELLLMHNRTFAAEIAHGVSSRKRIDIIARAKQLGVKVTNAKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.87
4 0.88
5 0.89
6 0.89
7 0.9
8 0.89
9 0.89
10 0.86
11 0.82
12 0.74
13 0.66
14 0.57
15 0.5
16 0.52
17 0.49
18 0.52
19 0.57
20 0.61
21 0.59
22 0.58
23 0.64
24 0.65
25 0.65
26 0.65
27 0.65
28 0.69
29 0.77
30 0.82
31 0.74
32 0.7
33 0.65
34 0.59
35 0.59
36 0.51
37 0.47
38 0.45
39 0.44
40 0.37
41 0.33
42 0.3
43 0.2
44 0.18
45 0.14
46 0.14
47 0.2
48 0.2
49 0.2
50 0.22
51 0.24
52 0.28
53 0.32
54 0.35
55 0.33
56 0.39
57 0.41
58 0.41
59 0.39
60 0.34
61 0.28
62 0.28
63 0.29
64 0.22
65 0.21
66 0.2
67 0.2
68 0.19
69 0.19
70 0.11
71 0.06
72 0.07
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.07
79 0.07
80 0.07
81 0.08
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.11
88 0.13
89 0.16
90 0.17
91 0.17
92 0.17
93 0.18
94 0.24
95 0.32
96 0.39
97 0.42
98 0.45
99 0.45
100 0.45
101 0.45
102 0.42
103 0.38
104 0.32
105 0.28
106 0.31
107 0.36
108 0.42
109 0.41
110 0.4
111 0.37