Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PP05

Protein Details
Accession A0A3N2PP05    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
75-98HTKSCNGCYNCKRRKVKRTGDVAVHydrophilic
175-195GLPESARKRRPPRQAGAYQNGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MYLYGSVSSTNSDFAAFWRSRHNGMSPHNSSHFRTNRTGVCHQIQYRRAHSRGALAPNLHPPAETGRKPVPRKGHTKSCNGCYNCKRRKVKRTGDVAVCLHFNCISLVSSIRPYPSSSAHTHTLDGSASRSVGSLVARSPSPPNVFTTIPTSFCMDDRYAGSVISGVPVYGEDMGLPESARKRRPPRQAGAYQNGPFELRAASWAETKSPVAKMASHHVLKNSNSSKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.2
3 0.18
4 0.19
5 0.26
6 0.29
7 0.31
8 0.34
9 0.37
10 0.37
11 0.44
12 0.53
13 0.49
14 0.51
15 0.54
16 0.54
17 0.53
18 0.55
19 0.54
20 0.49
21 0.5
22 0.5
23 0.49
24 0.53
25 0.54
26 0.5
27 0.48
28 0.5
29 0.51
30 0.53
31 0.55
32 0.54
33 0.58
34 0.6
35 0.57
36 0.52
37 0.49
38 0.48
39 0.47
40 0.46
41 0.41
42 0.35
43 0.35
44 0.39
45 0.39
46 0.32
47 0.25
48 0.21
49 0.24
50 0.3
51 0.29
52 0.28
53 0.34
54 0.42
55 0.46
56 0.51
57 0.54
58 0.53
59 0.62
60 0.64
61 0.67
62 0.64
63 0.71
64 0.7
65 0.67
66 0.69
67 0.62
68 0.64
69 0.62
70 0.67
71 0.65
72 0.69
73 0.73
74 0.73
75 0.82
76 0.83
77 0.85
78 0.82
79 0.83
80 0.8
81 0.73
82 0.68
83 0.58
84 0.48
85 0.39
86 0.3
87 0.22
88 0.15
89 0.12
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.09
97 0.09
98 0.09
99 0.09
100 0.1
101 0.11
102 0.13
103 0.16
104 0.17
105 0.21
106 0.24
107 0.24
108 0.23
109 0.22
110 0.2
111 0.16
112 0.14
113 0.11
114 0.08
115 0.07
116 0.07
117 0.06
118 0.06
119 0.07
120 0.07
121 0.06
122 0.07
123 0.08
124 0.08
125 0.09
126 0.11
127 0.14
128 0.17
129 0.17
130 0.19
131 0.21
132 0.21
133 0.21
134 0.25
135 0.22
136 0.21
137 0.21
138 0.21
139 0.18
140 0.18
141 0.19
142 0.15
143 0.15
144 0.14
145 0.16
146 0.15
147 0.14
148 0.13
149 0.11
150 0.1
151 0.09
152 0.08
153 0.05
154 0.05
155 0.05
156 0.06
157 0.05
158 0.05
159 0.04
160 0.05
161 0.06
162 0.06
163 0.06
164 0.09
165 0.15
166 0.21
167 0.27
168 0.36
169 0.45
170 0.54
171 0.65
172 0.71
173 0.74
174 0.78
175 0.81
176 0.81
177 0.8
178 0.78
179 0.7
180 0.61
181 0.53
182 0.44
183 0.35
184 0.27
185 0.2
186 0.11
187 0.11
188 0.13
189 0.14
190 0.17
191 0.17
192 0.18
193 0.2
194 0.21
195 0.23
196 0.22
197 0.24
198 0.22
199 0.24
200 0.25
201 0.32
202 0.39
203 0.38
204 0.4
205 0.41
206 0.46
207 0.45
208 0.52