Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PND2

Protein Details
Accession A0A3N2PND2   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
81-106LQKLTNKQRGRNKKIIKQMQNKMLKAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 8, mito 5, E.R. 4, mito_nucl 4, nucl 3, golg 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPGQGLRTGTWSGINIPAHHLSHFREVVTTIQGYTIRRQDSKCVFNACLAIFFFFPMSISILHFSLFFSFPTSPIRFHSSLQKLTNKQRGRNKKIIKQMQNKMLKALDAKPLRPEDSLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.24
4 0.27
5 0.26
6 0.26
7 0.27
8 0.24
9 0.29
10 0.29
11 0.25
12 0.21
13 0.22
14 0.22
15 0.22
16 0.19
17 0.12
18 0.13
19 0.15
20 0.16
21 0.19
22 0.23
23 0.24
24 0.26
25 0.27
26 0.34
27 0.38
28 0.4
29 0.4
30 0.39
31 0.36
32 0.34
33 0.35
34 0.27
35 0.22
36 0.18
37 0.15
38 0.11
39 0.1
40 0.09
41 0.07
42 0.07
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.08
54 0.07
55 0.09
56 0.09
57 0.1
58 0.16
59 0.17
60 0.16
61 0.19
62 0.25
63 0.24
64 0.25
65 0.34
66 0.34
67 0.39
68 0.43
69 0.48
70 0.48
71 0.56
72 0.64
73 0.6
74 0.63
75 0.67
76 0.73
77 0.75
78 0.79
79 0.8
80 0.78
81 0.83
82 0.85
83 0.85
84 0.84
85 0.84
86 0.84
87 0.83
88 0.76
89 0.69
90 0.6
91 0.52
92 0.45
93 0.4
94 0.39
95 0.35
96 0.37
97 0.39
98 0.43
99 0.43