Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N2PNM2

Protein Details
Accession A0A3N2PNM2    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-42LLWKIPWRLSKFQKRRQRQRLRAVDSVVHydrophilic
77-103KYTMFDRKEKRYRKGIHKLPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
84-96KEKRYRKGIHKLP
Subcellular Location(s) mito 25.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITSPLSGGLLWKIPWRLSKFQKRRQRQRLRAVDSVVATVDAALAKKGVTVAAVEHWKKEMPTEAEMLPRDKYTMFDRKEKRYRKGIHKLPKWTRVSQRLNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.18
5 0.17
6 0.19
7 0.26
8 0.31
9 0.38
10 0.47
11 0.57
12 0.64
13 0.72
14 0.8
15 0.84
16 0.89
17 0.92
18 0.93
19 0.91
20 0.92
21 0.92
22 0.89
23 0.82
24 0.73
25 0.64
26 0.53
27 0.43
28 0.32
29 0.22
30 0.14
31 0.1
32 0.07
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.07
45 0.12
46 0.13
47 0.13
48 0.14
49 0.14
50 0.14
51 0.15
52 0.17
53 0.15
54 0.17
55 0.19
56 0.19
57 0.23
58 0.24
59 0.25
60 0.2
61 0.17
62 0.17
63 0.14
64 0.16
65 0.19
66 0.27
67 0.29
68 0.37
69 0.43
70 0.53
71 0.63
72 0.69
73 0.7
74 0.71
75 0.77
76 0.78
77 0.82
78 0.82
79 0.83
80 0.83
81 0.87
82 0.86
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79