Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2Q895

Protein Details
Accession A0A3N2Q895   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
290-316QFRMSKKAVKVDRRRQNELDRRRQNELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, cyto_mito 10, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR047545  BRcat_RBR_RNF216  
IPR047544  RING-HC_RBR_RNF216  
IPR044066  TRIAD_supradom  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0016740  F:transferase activity  
PROSITE View protein in PROSITE  
PS51873  TRIAD  
CDD cd20339  BRcat_RBR_RNF216  
cd16630  RING-HC_RBR_RNF216  
Amino Acid Sequences RAARWVIRARVAKQEAANREKQQEEDNIALAQAQGSMMGCACCYDEFPINRMVHCNEKQWFCIGCARQNAETVVGMSRYELKCMSMDGCSAGFCAGQRALFIDPKLAAALERIEDEAVLRMAAITNLETCPSCPYAAEYPPVEENKEFRCQNPDCLLVSCRLCRQDTHIPKTCQEAAHDSGISARRQIEEAMSAALIRKCNKCQTPFVKIEGCNRMTCPQPGCHNVQCYVCSQSCAYNHFDDERRGGRAGNCPLFDSLEERHQAEVRRAEEEARRKVMAENPAVDPRLLQFRMSKKAVKVDRRRQNELDRRRQNELDRRRHEEALAAALHASGLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.58
4 0.63
5 0.57
6 0.6
7 0.57
8 0.53
9 0.5
10 0.47
11 0.45
12 0.39
13 0.35
14 0.29
15 0.27
16 0.25
17 0.19
18 0.13
19 0.09
20 0.06
21 0.06
22 0.06
23 0.06
24 0.07
25 0.07
26 0.06
27 0.07
28 0.08
29 0.08
30 0.09
31 0.12
32 0.18
33 0.2
34 0.22
35 0.3
36 0.29
37 0.3
38 0.33
39 0.33
40 0.35
41 0.36
42 0.4
43 0.39
44 0.41
45 0.42
46 0.42
47 0.4
48 0.34
49 0.39
50 0.35
51 0.35
52 0.39
53 0.41
54 0.38
55 0.38
56 0.37
57 0.3
58 0.27
59 0.22
60 0.17
61 0.14
62 0.12
63 0.11
64 0.18
65 0.16
66 0.18
67 0.17
68 0.17
69 0.17
70 0.18
71 0.19
72 0.12
73 0.12
74 0.11
75 0.11
76 0.1
77 0.1
78 0.09
79 0.08
80 0.07
81 0.09
82 0.09
83 0.09
84 0.09
85 0.1
86 0.12
87 0.14
88 0.14
89 0.13
90 0.13
91 0.13
92 0.13
93 0.11
94 0.09
95 0.08
96 0.09
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.05
107 0.04
108 0.05
109 0.05
110 0.05
111 0.04
112 0.05
113 0.05
114 0.06
115 0.07
116 0.07
117 0.09
118 0.1
119 0.1
120 0.09
121 0.12
122 0.15
123 0.17
124 0.19
125 0.17
126 0.17
127 0.2
128 0.21
129 0.19
130 0.16
131 0.17
132 0.18
133 0.24
134 0.23
135 0.21
136 0.28
137 0.28
138 0.33
139 0.33
140 0.32
141 0.26
142 0.27
143 0.27
144 0.22
145 0.23
146 0.19
147 0.19
148 0.19
149 0.18
150 0.17
151 0.23
152 0.3
153 0.37
154 0.43
155 0.49
156 0.48
157 0.48
158 0.52
159 0.48
160 0.39
161 0.32
162 0.29
163 0.23
164 0.23
165 0.22
166 0.17
167 0.18
168 0.2
169 0.19
170 0.16
171 0.14
172 0.13
173 0.13
174 0.14
175 0.11
176 0.09
177 0.09
178 0.08
179 0.07
180 0.07
181 0.09
182 0.1
183 0.12
184 0.14
185 0.17
186 0.2
187 0.27
188 0.33
189 0.34
190 0.42
191 0.46
192 0.5
193 0.5
194 0.51
195 0.5
196 0.47
197 0.5
198 0.48
199 0.44
200 0.37
201 0.36
202 0.34
203 0.31
204 0.32
205 0.28
206 0.25
207 0.29
208 0.32
209 0.36
210 0.38
211 0.38
212 0.37
213 0.36
214 0.33
215 0.29
216 0.3
217 0.25
218 0.22
219 0.2
220 0.22
221 0.22
222 0.24
223 0.26
224 0.22
225 0.24
226 0.26
227 0.28
228 0.26
229 0.29
230 0.28
231 0.27
232 0.26
233 0.27
234 0.26
235 0.31
236 0.37
237 0.36
238 0.34
239 0.33
240 0.33
241 0.32
242 0.29
243 0.25
244 0.19
245 0.2
246 0.22
247 0.21
248 0.22
249 0.25
250 0.26
251 0.29
252 0.33
253 0.29
254 0.29
255 0.29
256 0.31
257 0.36
258 0.42
259 0.43
260 0.41
261 0.39
262 0.38
263 0.41
264 0.43
265 0.43
266 0.39
267 0.35
268 0.35
269 0.39
270 0.39
271 0.36
272 0.3
273 0.25
274 0.28
275 0.26
276 0.24
277 0.26
278 0.32
279 0.41
280 0.45
281 0.48
282 0.43
283 0.53
284 0.6
285 0.64
286 0.69
287 0.71
288 0.77
289 0.79
290 0.83
291 0.81
292 0.83
293 0.83
294 0.82
295 0.83
296 0.83
297 0.8
298 0.8
299 0.79
300 0.77
301 0.77
302 0.77
303 0.77
304 0.75
305 0.78
306 0.76
307 0.72
308 0.63
309 0.57
310 0.49
311 0.43
312 0.36
313 0.27
314 0.22
315 0.19