Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N2PJP2

Protein Details
Accession A0A3N2PJP2   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-73AAPRSIPKERNKKKTRSGNDHydrophilic
NLS Segment(s)
PositionSequence
61-67KERNKKK
Subcellular Location(s) nucl 12, cyto_nucl 11.5, cyto 9, mito 3
Family & Domain DBs
Amino Acid Sequences MAEAPVNGNASDEVTTVKTSNTQPTRRTAETLAEGAQPSVTLTAEESHLSHADAAPRSIPKERNKKKTRSGNDIGMALWKLLVHREQAAMFRDSEVCGAWFPERGPRVEDEVMEARIKETK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.12
5 0.15
6 0.17
7 0.27
8 0.34
9 0.38
10 0.4
11 0.47
12 0.54
13 0.51
14 0.52
15 0.44
16 0.4
17 0.37
18 0.35
19 0.29
20 0.24
21 0.22
22 0.18
23 0.16
24 0.11
25 0.09
26 0.08
27 0.06
28 0.05
29 0.05
30 0.06
31 0.07
32 0.07
33 0.08
34 0.08
35 0.09
36 0.09
37 0.08
38 0.08
39 0.11
40 0.11
41 0.11
42 0.11
43 0.12
44 0.13
45 0.17
46 0.23
47 0.28
48 0.39
49 0.48
50 0.57
51 0.64
52 0.7
53 0.76
54 0.8
55 0.79
56 0.77
57 0.73
58 0.68
59 0.61
60 0.54
61 0.44
62 0.36
63 0.29
64 0.19
65 0.14
66 0.08
67 0.07
68 0.08
69 0.09
70 0.09
71 0.1
72 0.12
73 0.13
74 0.16
75 0.19
76 0.19
77 0.18
78 0.17
79 0.17
80 0.16
81 0.16
82 0.13
83 0.1
84 0.09
85 0.11
86 0.1
87 0.11
88 0.11
89 0.19
90 0.21
91 0.21
92 0.24
93 0.25
94 0.31
95 0.31
96 0.31
97 0.29
98 0.3
99 0.31
100 0.29
101 0.27