Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XIP7

Protein Details
Accession A0A4P9XIP7   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
86-113VMTEHATTKKRKKLWRRKDARFEYPYKEHydrophilic
NLS Segment(s)
PositionSequence
94-104KKRKKLWRRKD
Subcellular Location(s) mito 10.5, cyto_mito 9.833, cyto 8, cyto_nucl 7.833, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009446  Mgm101  
Gene Ontology GO:0000262  C:mitochondrial chromosome  
GO:0003697  F:single-stranded DNA binding  
GO:0006281  P:DNA repair  
GO:0000002  P:mitochondrial genome maintenance  
Pfam View protein in Pfam  
PF06420  Mgm101p  
Amino Acid Sequences WGLAPRGEHSVSPRTISREYALVCHGRFVAQARGEQDYFDPNGLATASEGCKSNALMRCCKDLGIASELWDPSFIRKFKSEVCVDVMTEHATTKKRKKLWRRKDARFEYPYKEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.35
4 0.32
5 0.29
6 0.28
7 0.27
8 0.28
9 0.27
10 0.25
11 0.25
12 0.23
13 0.18
14 0.19
15 0.19
16 0.22
17 0.19
18 0.21
19 0.22
20 0.25
21 0.25
22 0.24
23 0.22
24 0.18
25 0.17
26 0.15
27 0.13
28 0.09
29 0.09
30 0.09
31 0.08
32 0.05
33 0.06
34 0.07
35 0.08
36 0.09
37 0.08
38 0.09
39 0.09
40 0.15
41 0.18
42 0.2
43 0.24
44 0.25
45 0.28
46 0.27
47 0.27
48 0.22
49 0.18
50 0.18
51 0.16
52 0.14
53 0.13
54 0.15
55 0.15
56 0.14
57 0.13
58 0.11
59 0.12
60 0.18
61 0.17
62 0.18
63 0.2
64 0.22
65 0.25
66 0.32
67 0.31
68 0.27
69 0.31
70 0.3
71 0.28
72 0.26
73 0.23
74 0.18
75 0.16
76 0.15
77 0.14
78 0.18
79 0.26
80 0.34
81 0.42
82 0.49
83 0.59
84 0.7
85 0.77
86 0.84
87 0.87
88 0.89
89 0.91
90 0.94
91 0.93
92 0.92
93 0.88
94 0.83