Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9XJ69

Protein Details
Accession A0A4P9XJ69    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
20-43VEAQEKKKKKTGRAKKRECYLRRFBasic
NLS Segment(s)
PositionSequence
18-36PKVEAQEKKKKKTGRAKKR
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences GKVHGSLARAGKVKSQTPKVEAQEKKKKKTGRAKKRECYLRRFVNVTLVGGKRRVGAAQLVHLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.46
4 0.47
5 0.53
6 0.53
7 0.57
8 0.57
9 0.59
10 0.62
11 0.66
12 0.69
13 0.68
14 0.69
15 0.69
16 0.74
17 0.75
18 0.75
19 0.79
20 0.82
21 0.83
22 0.87
23 0.87
24 0.82
25 0.78
26 0.76
27 0.73
28 0.67
29 0.62
30 0.53
31 0.51
32 0.46
33 0.4
34 0.36
35 0.3
36 0.28
37 0.27
38 0.27
39 0.2
40 0.2
41 0.2
42 0.16
43 0.19
44 0.19