Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XIH9

Protein Details
Accession A0A4P9XIH9   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
56-79GGGSSHVRRRIKKRDQDLSRHYKVBasic
NLS Segment(s)
PositionSequence
55-69RGGGSSHVRRRIKKR
Subcellular Location(s) cyto_nucl 11.5, nucl 10, cyto 9, mito 4, pero 2, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024610  ING_N_histone-binding  
Pfam View protein in Pfam  
PF12998  ING  
Amino Acid Sequences MRPDNVLEQQSLAILEDVGLYLQDFVAGLDNLPSEVIHLLAELRKKEEQFQGKWRGGGSSHVRRRIKKRDQDLSRHYKVYGYALDEPSKAGLDGARRKDAEKTGDGDGGNDESVPMEVDRKDSVSTNADVDKSAAAMEKDGAENSAAKVPDTSEEAGADAQKAVKPDGVDAAIADGELEKSGDAAAEKAAGSATLEKPAAKESNTASAESNAATSKATKLDAEQIRRLERRKQQERDMIEHIREDFRRAEELSAEKMEITARAIELASARICCAQSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.07
5 0.06
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.04
12 0.05
13 0.07
14 0.08
15 0.07
16 0.08
17 0.09
18 0.09
19 0.09
20 0.08
21 0.07
22 0.07
23 0.07
24 0.06
25 0.06
26 0.08
27 0.11
28 0.15
29 0.15
30 0.2
31 0.23
32 0.24
33 0.3
34 0.37
35 0.43
36 0.44
37 0.53
38 0.58
39 0.56
40 0.57
41 0.51
42 0.44
43 0.37
44 0.39
45 0.38
46 0.4
47 0.44
48 0.53
49 0.58
50 0.64
51 0.73
52 0.76
53 0.78
54 0.77
55 0.8
56 0.81
57 0.83
58 0.85
59 0.86
60 0.84
61 0.78
62 0.7
63 0.6
64 0.51
65 0.44
66 0.37
67 0.3
68 0.24
69 0.25
70 0.25
71 0.27
72 0.25
73 0.24
74 0.21
75 0.19
76 0.14
77 0.09
78 0.09
79 0.14
80 0.22
81 0.25
82 0.29
83 0.29
84 0.3
85 0.34
86 0.37
87 0.34
88 0.29
89 0.28
90 0.25
91 0.28
92 0.27
93 0.23
94 0.19
95 0.16
96 0.13
97 0.1
98 0.08
99 0.05
100 0.05
101 0.05
102 0.05
103 0.06
104 0.06
105 0.08
106 0.08
107 0.09
108 0.1
109 0.1
110 0.13
111 0.13
112 0.14
113 0.14
114 0.15
115 0.14
116 0.13
117 0.13
118 0.1
119 0.08
120 0.07
121 0.07
122 0.05
123 0.05
124 0.05
125 0.06
126 0.06
127 0.06
128 0.06
129 0.05
130 0.06
131 0.06
132 0.09
133 0.08
134 0.08
135 0.08
136 0.09
137 0.09
138 0.11
139 0.11
140 0.08
141 0.09
142 0.09
143 0.09
144 0.09
145 0.08
146 0.06
147 0.06
148 0.07
149 0.08
150 0.08
151 0.09
152 0.09
153 0.09
154 0.11
155 0.1
156 0.09
157 0.08
158 0.08
159 0.06
160 0.06
161 0.05
162 0.04
163 0.03
164 0.04
165 0.04
166 0.03
167 0.03
168 0.03
169 0.04
170 0.04
171 0.04
172 0.04
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.05
179 0.09
180 0.09
181 0.11
182 0.12
183 0.12
184 0.13
185 0.17
186 0.18
187 0.15
188 0.18
189 0.17
190 0.26
191 0.26
192 0.27
193 0.24
194 0.23
195 0.23
196 0.2
197 0.19
198 0.11
199 0.1
200 0.1
201 0.09
202 0.1
203 0.12
204 0.13
205 0.12
206 0.13
207 0.22
208 0.29
209 0.34
210 0.37
211 0.4
212 0.47
213 0.52
214 0.54
215 0.54
216 0.56
217 0.62
218 0.67
219 0.7
220 0.72
221 0.75
222 0.77
223 0.74
224 0.72
225 0.66
226 0.57
227 0.53
228 0.46
229 0.44
230 0.38
231 0.35
232 0.31
233 0.28
234 0.3
235 0.29
236 0.28
237 0.25
238 0.28
239 0.29
240 0.27
241 0.25
242 0.21
243 0.2
244 0.2
245 0.16
246 0.15
247 0.12
248 0.11
249 0.11
250 0.11
251 0.12
252 0.12
253 0.14
254 0.14
255 0.13
256 0.14
257 0.16