Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XRA2

Protein Details
Accession A0A4P9XRA2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
94-116VDPYFISKPDKRLRKKMKQKPRKBasic
NLS Segment(s)
PositionSequence
101-116KPDKRLRKKMKQKPRK
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF09597  IGR  
Amino Acid Sequences MFARLFARSLARPAPMRAFSSAAKQSIPTPRGAITDHTVFLSKIGRSCEGLGDKIQDWNHLFTVTSNEMKHQLGFTPKQRRWILNWTEKYRQGVDPYFISKPDKRLRKKMKQKPRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.36
4 0.34
5 0.34
6 0.3
7 0.35
8 0.36
9 0.3
10 0.27
11 0.25
12 0.28
13 0.34
14 0.34
15 0.28
16 0.26
17 0.26
18 0.27
19 0.28
20 0.25
21 0.21
22 0.21
23 0.2
24 0.19
25 0.18
26 0.16
27 0.16
28 0.16
29 0.12
30 0.13
31 0.15
32 0.15
33 0.16
34 0.16
35 0.19
36 0.17
37 0.18
38 0.16
39 0.16
40 0.15
41 0.17
42 0.17
43 0.16
44 0.16
45 0.16
46 0.16
47 0.14
48 0.14
49 0.1
50 0.15
51 0.14
52 0.15
53 0.14
54 0.15
55 0.17
56 0.17
57 0.17
58 0.13
59 0.13
60 0.17
61 0.21
62 0.29
63 0.37
64 0.38
65 0.47
66 0.5
67 0.51
68 0.51
69 0.56
70 0.56
71 0.56
72 0.64
73 0.61
74 0.64
75 0.64
76 0.63
77 0.56
78 0.5
79 0.46
80 0.4
81 0.37
82 0.34
83 0.35
84 0.33
85 0.32
86 0.35
87 0.32
88 0.38
89 0.45
90 0.52
91 0.57
92 0.67
93 0.75
94 0.8
95 0.88
96 0.9