Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XJ21

Protein Details
Accession A0A4P9XJ21   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGRSAKFRKRPSRKERELRGLGGBasic
NLS Segment(s)
PositionSequence
5-17AKFRKRPSRKERE
112-141KSKSVAGAAGKAADLKKRLGGGKGAGKQRK
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
Amino Acid Sequences MGRSAKFRKRPSRKERELRGLGGEVAEKTPQTHTGNEDTAMETTLEEEAFAFFTKSASTVAAKTKTVATPSAVDGGKKGRTETVAERRARLLSGRLGVATSAIGSGSSRIGKSKSVAGAAGKAADLKKRLGGGKGAGKQRKDYVDLLYGKQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.93
4 0.87
5 0.79
6 0.72
7 0.62
8 0.51
9 0.41
10 0.33
11 0.23
12 0.18
13 0.16
14 0.12
15 0.12
16 0.13
17 0.18
18 0.19
19 0.2
20 0.22
21 0.26
22 0.27
23 0.27
24 0.26
25 0.21
26 0.19
27 0.18
28 0.14
29 0.09
30 0.09
31 0.08
32 0.07
33 0.06
34 0.06
35 0.05
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.06
44 0.07
45 0.08
46 0.1
47 0.14
48 0.16
49 0.16
50 0.17
51 0.18
52 0.18
53 0.18
54 0.17
55 0.14
56 0.13
57 0.14
58 0.17
59 0.15
60 0.14
61 0.14
62 0.16
63 0.17
64 0.16
65 0.16
66 0.12
67 0.13
68 0.17
69 0.23
70 0.3
71 0.35
72 0.35
73 0.36
74 0.36
75 0.35
76 0.33
77 0.27
78 0.2
79 0.15
80 0.16
81 0.15
82 0.14
83 0.13
84 0.13
85 0.12
86 0.09
87 0.06
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.06
94 0.08
95 0.08
96 0.1
97 0.12
98 0.13
99 0.15
100 0.19
101 0.19
102 0.19
103 0.2
104 0.19
105 0.2
106 0.19
107 0.18
108 0.13
109 0.14
110 0.14
111 0.16
112 0.17
113 0.17
114 0.19
115 0.23
116 0.26
117 0.26
118 0.28
119 0.3
120 0.37
121 0.43
122 0.5
123 0.52
124 0.52
125 0.54
126 0.57
127 0.55
128 0.5
129 0.46
130 0.41
131 0.44
132 0.44