Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XU86

Protein Details
Accession A0A4P9XU86    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-130NLADTTRTSRKQRKERKNRAKKFRGTEKAKAAGTHydrophilic
NLS Segment(s)
PositionSequence
105-133SRKQRKERKNRAKKFRGTEKAKAAGTGKK
Subcellular Location(s) mito 15, nucl 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADAPTATLRTRKFLTNRLLQRKQMVVDAIHPGRASLSKDEIREKLSKMYKTDKESIFVFGFRIQFGGGKSTGFALIYDSLDAAKRFEPKYRLARHNLADTTRTSRKQRKERKNRAKKFRGTEKAKAAGTGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.54
4 0.63
5 0.68
6 0.72
7 0.68
8 0.68
9 0.63
10 0.57
11 0.5
12 0.42
13 0.32
14 0.29
15 0.33
16 0.28
17 0.26
18 0.24
19 0.2
20 0.19
21 0.2
22 0.2
23 0.15
24 0.2
25 0.22
26 0.25
27 0.29
28 0.3
29 0.32
30 0.32
31 0.31
32 0.33
33 0.36
34 0.37
35 0.37
36 0.43
37 0.45
38 0.48
39 0.54
40 0.46
41 0.42
42 0.4
43 0.4
44 0.31
45 0.26
46 0.21
47 0.16
48 0.16
49 0.13
50 0.12
51 0.09
52 0.09
53 0.09
54 0.11
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.07
61 0.06
62 0.06
63 0.07
64 0.07
65 0.07
66 0.06
67 0.07
68 0.08
69 0.08
70 0.08
71 0.09
72 0.14
73 0.15
74 0.2
75 0.23
76 0.29
77 0.39
78 0.46
79 0.51
80 0.53
81 0.59
82 0.57
83 0.6
84 0.56
85 0.48
86 0.42
87 0.37
88 0.38
89 0.39
90 0.41
91 0.43
92 0.49
93 0.58
94 0.67
95 0.75
96 0.79
97 0.84
98 0.9
99 0.93
100 0.95
101 0.95
102 0.96
103 0.95
104 0.93
105 0.92
106 0.91
107 0.91
108 0.87
109 0.86
110 0.83
111 0.8
112 0.71
113 0.65