Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9XUE4

Protein Details
Accession A0A4P9XUE4    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
26-47QTLPRHLRRRAASHNPKRLPARHydrophilic
63-84AGMAKHQQSRRARRRPGAIAAEHydrophilic
495-514AERHERRPPAKRPNYTKLQVHydrophilic
599-619LSHASRRPSNGRQRRLARDADHydrophilic
NLS Segment(s)
PositionSequence
29-81PRHLRRRAASHNPKRLPARVRGKALREASARRQCAGMAKHQQSRRARRRPGAI
Subcellular Location(s) mito 17, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039182  Pop1  
IPR009723  Pop1_N  
IPR012590  POPLD_dom  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF06978  POP1  
PF08170  POPLD  
Amino Acid Sequences ARAFEIQAMRNAMKTAKLAANKRVFQTLPRHLRRRAASHNPKRLPARVRGKALREASARRQCAGMAKHQQSRRARRRPGAIAAEYRRRQEEKLWLETHIWHTKRMKMTDIWGYRLAEHPNEKGARSAYRSGSHIAMMHDASYHGCIELSGPQQALMRLLRAVTAPNLPGPASTRFISGTRQCSSMFYHPGCFPANAIAPAMAHWQPVDGTTAATAGTDDPVRCLWLWFHPAAFDEALVMLREAAVQPDYVGPTTAAISVRDLRQKLLVFDFIGPRAHNLLYSVLKPCSDDTSNAQALKLWSLLNGIHSTASLPPGVILGLDVHDPRLSFPPRPSRGTESDLGDINELQAHLTNWPDNVAVSKIWCEETRVQIQQNMIPEKNLNRRRQALLVPGEPLAPTAADARIPILLVQRGSGSVGANKTQIARELEYGWRLILPAGWGNAFWKSLVFAGIRVGGLRECRGHHLEAGLPCFPYDYPGTKAYACWSAKEASVAAERHERRPPAKRPNYTKLQVPAPFEPAFASLNADADSSTLPTYVLPASMVRQALAADAYTHVVAMPGALSLVRVRIRMHDRGVVSRCAIIYALDAARYASTADTLSHASRRPSNGRQRRLARDADEVRVCARGKRHISCYKWQCCIVQATLQDAALPEASAIIGYVTTGQFSLSQGRGAAIGCCAADRLIPYFRDAAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.27
4 0.35
5 0.39
6 0.47
7 0.55
8 0.57
9 0.58
10 0.58
11 0.53
12 0.52
13 0.56
14 0.57
15 0.59
16 0.64
17 0.69
18 0.68
19 0.76
20 0.76
21 0.75
22 0.75
23 0.75
24 0.77
25 0.8
26 0.86
27 0.82
28 0.82
29 0.8
30 0.78
31 0.73
32 0.73
33 0.73
34 0.7
35 0.75
36 0.74
37 0.74
38 0.74
39 0.71
40 0.67
41 0.63
42 0.61
43 0.62
44 0.64
45 0.61
46 0.53
47 0.5
48 0.44
49 0.46
50 0.43
51 0.42
52 0.43
53 0.49
54 0.56
55 0.59
56 0.67
57 0.69
58 0.76
59 0.77
60 0.77
61 0.79
62 0.8
63 0.85
64 0.83
65 0.82
66 0.79
67 0.74
68 0.72
69 0.71
70 0.72
71 0.67
72 0.63
73 0.6
74 0.54
75 0.5
76 0.48
77 0.51
78 0.47
79 0.53
80 0.5
81 0.46
82 0.46
83 0.48
84 0.49
85 0.47
86 0.41
87 0.4
88 0.43
89 0.48
90 0.54
91 0.52
92 0.49
93 0.43
94 0.47
95 0.5
96 0.49
97 0.47
98 0.43
99 0.41
100 0.38
101 0.39
102 0.37
103 0.33
104 0.33
105 0.3
106 0.34
107 0.35
108 0.34
109 0.33
110 0.32
111 0.32
112 0.33
113 0.37
114 0.34
115 0.35
116 0.37
117 0.36
118 0.34
119 0.31
120 0.28
121 0.23
122 0.21
123 0.18
124 0.16
125 0.14
126 0.13
127 0.12
128 0.11
129 0.1
130 0.08
131 0.07
132 0.07
133 0.08
134 0.13
135 0.14
136 0.14
137 0.14
138 0.15
139 0.17
140 0.17
141 0.19
142 0.15
143 0.14
144 0.13
145 0.13
146 0.12
147 0.12
148 0.13
149 0.11
150 0.13
151 0.13
152 0.13
153 0.14
154 0.13
155 0.13
156 0.15
157 0.17
158 0.18
159 0.17
160 0.18
161 0.18
162 0.2
163 0.26
164 0.28
165 0.31
166 0.29
167 0.3
168 0.29
169 0.3
170 0.34
171 0.33
172 0.34
173 0.3
174 0.31
175 0.3
176 0.33
177 0.32
178 0.27
179 0.22
180 0.18
181 0.19
182 0.16
183 0.16
184 0.13
185 0.11
186 0.12
187 0.15
188 0.12
189 0.1
190 0.09
191 0.09
192 0.09
193 0.1
194 0.12
195 0.08
196 0.08
197 0.07
198 0.08
199 0.07
200 0.07
201 0.07
202 0.05
203 0.06
204 0.08
205 0.07
206 0.09
207 0.09
208 0.1
209 0.1
210 0.11
211 0.11
212 0.13
213 0.17
214 0.17
215 0.16
216 0.16
217 0.17
218 0.18
219 0.16
220 0.12
221 0.08
222 0.08
223 0.08
224 0.08
225 0.07
226 0.04
227 0.04
228 0.05
229 0.05
230 0.05
231 0.05
232 0.05
233 0.05
234 0.07
235 0.08
236 0.07
237 0.08
238 0.07
239 0.07
240 0.08
241 0.09
242 0.09
243 0.08
244 0.1
245 0.12
246 0.15
247 0.19
248 0.19
249 0.18
250 0.22
251 0.22
252 0.22
253 0.22
254 0.2
255 0.17
256 0.18
257 0.19
258 0.16
259 0.17
260 0.15
261 0.14
262 0.14
263 0.13
264 0.11
265 0.11
266 0.13
267 0.13
268 0.14
269 0.16
270 0.14
271 0.15
272 0.15
273 0.15
274 0.16
275 0.16
276 0.16
277 0.18
278 0.24
279 0.26
280 0.26
281 0.25
282 0.22
283 0.21
284 0.2
285 0.17
286 0.1
287 0.08
288 0.09
289 0.09
290 0.09
291 0.09
292 0.09
293 0.07
294 0.07
295 0.08
296 0.08
297 0.08
298 0.07
299 0.06
300 0.06
301 0.06
302 0.06
303 0.04
304 0.04
305 0.03
306 0.04
307 0.05
308 0.05
309 0.05
310 0.06
311 0.06
312 0.07
313 0.13
314 0.15
315 0.16
316 0.21
317 0.31
318 0.35
319 0.38
320 0.4
321 0.4
322 0.42
323 0.44
324 0.41
325 0.34
326 0.31
327 0.29
328 0.26
329 0.2
330 0.16
331 0.12
332 0.09
333 0.07
334 0.05
335 0.05
336 0.05
337 0.05
338 0.06
339 0.07
340 0.06
341 0.07
342 0.07
343 0.06
344 0.07
345 0.07
346 0.07
347 0.06
348 0.07
349 0.07
350 0.09
351 0.09
352 0.12
353 0.14
354 0.18
355 0.22
356 0.24
357 0.24
358 0.25
359 0.26
360 0.24
361 0.27
362 0.26
363 0.21
364 0.19
365 0.2
366 0.23
367 0.33
368 0.39
369 0.39
370 0.4
371 0.44
372 0.46
373 0.48
374 0.45
375 0.42
376 0.38
377 0.34
378 0.3
379 0.26
380 0.24
381 0.2
382 0.18
383 0.11
384 0.06
385 0.06
386 0.06
387 0.06
388 0.06
389 0.06
390 0.06
391 0.06
392 0.06
393 0.07
394 0.08
395 0.09
396 0.08
397 0.09
398 0.09
399 0.08
400 0.09
401 0.09
402 0.07
403 0.09
404 0.1
405 0.11
406 0.11
407 0.11
408 0.12
409 0.12
410 0.15
411 0.15
412 0.15
413 0.16
414 0.18
415 0.19
416 0.19
417 0.18
418 0.14
419 0.12
420 0.11
421 0.09
422 0.08
423 0.07
424 0.07
425 0.08
426 0.08
427 0.08
428 0.08
429 0.09
430 0.09
431 0.08
432 0.07
433 0.07
434 0.07
435 0.09
436 0.09
437 0.08
438 0.09
439 0.1
440 0.1
441 0.09
442 0.09
443 0.08
444 0.09
445 0.11
446 0.12
447 0.12
448 0.17
449 0.2
450 0.2
451 0.2
452 0.2
453 0.23
454 0.23
455 0.25
456 0.21
457 0.18
458 0.17
459 0.17
460 0.15
461 0.14
462 0.14
463 0.14
464 0.17
465 0.18
466 0.21
467 0.2
468 0.21
469 0.21
470 0.27
471 0.24
472 0.21
473 0.22
474 0.22
475 0.22
476 0.22
477 0.2
478 0.14
479 0.19
480 0.18
481 0.18
482 0.25
483 0.27
484 0.31
485 0.36
486 0.38
487 0.39
488 0.48
489 0.56
490 0.58
491 0.66
492 0.71
493 0.75
494 0.79
495 0.82
496 0.75
497 0.72
498 0.65
499 0.63
500 0.58
501 0.54
502 0.48
503 0.44
504 0.42
505 0.35
506 0.31
507 0.25
508 0.21
509 0.16
510 0.17
511 0.11
512 0.12
513 0.12
514 0.11
515 0.09
516 0.09
517 0.09
518 0.07
519 0.07
520 0.07
521 0.06
522 0.06
523 0.08
524 0.08
525 0.08
526 0.08
527 0.08
528 0.1
529 0.14
530 0.14
531 0.12
532 0.12
533 0.12
534 0.12
535 0.11
536 0.1
537 0.07
538 0.07
539 0.08
540 0.08
541 0.08
542 0.07
543 0.06
544 0.06
545 0.05
546 0.05
547 0.03
548 0.04
549 0.04
550 0.04
551 0.05
552 0.1
553 0.11
554 0.13
555 0.14
556 0.22
557 0.28
558 0.33
559 0.36
560 0.37
561 0.38
562 0.45
563 0.48
564 0.43
565 0.38
566 0.34
567 0.31
568 0.26
569 0.23
570 0.15
571 0.13
572 0.14
573 0.13
574 0.11
575 0.11
576 0.11
577 0.11
578 0.11
579 0.1
580 0.07
581 0.07
582 0.08
583 0.08
584 0.1
585 0.12
586 0.14
587 0.18
588 0.21
589 0.24
590 0.29
591 0.36
592 0.42
593 0.49
594 0.58
595 0.65
596 0.7
597 0.76
598 0.8
599 0.82
600 0.8
601 0.77
602 0.69
603 0.69
604 0.65
605 0.62
606 0.56
607 0.48
608 0.42
609 0.41
610 0.38
611 0.32
612 0.33
613 0.35
614 0.4
615 0.46
616 0.55
617 0.59
618 0.64
619 0.71
620 0.77
621 0.75
622 0.72
623 0.69
624 0.61
625 0.56
626 0.55
627 0.47
628 0.42
629 0.36
630 0.34
631 0.32
632 0.3
633 0.27
634 0.22
635 0.2
636 0.15
637 0.13
638 0.09
639 0.07
640 0.07
641 0.06
642 0.06
643 0.04
644 0.04
645 0.04
646 0.07
647 0.06
648 0.07
649 0.07
650 0.08
651 0.09
652 0.11
653 0.17
654 0.15
655 0.17
656 0.17
657 0.17
658 0.18
659 0.17
660 0.17
661 0.11
662 0.12
663 0.11
664 0.1
665 0.11
666 0.1
667 0.1
668 0.12
669 0.15
670 0.19
671 0.2
672 0.23