Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LAT6

Protein Details
Accession E2LAT6   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
113-136EVVKWFQPTRKKIKHYRTNSTLTSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.666, cyto 12.5, nucl 10.5, cyto_mito 8.999, mito_nucl 7.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR032454  Histone_H2A_C  
KEGG mpr:MPER_03213  -  
Pfam View protein in Pfam  
PF16211  Histone_H2A_C  
Amino Acid Sequences GGVVPHIESSLLPSKSGKGKKDEGISQECSSATTYNPQLIVVIWCSGATVLGPYEKESPTXEPPIPGLHPRNNDKEGSYFCEQRSESELRILLVSESPEKRDIGVKNIKKSEMEVVKWFQPTRKKIKHYRTNSTLTSKVVREMKKCLVLAQFHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.35
3 0.42
4 0.41
5 0.4
6 0.46
7 0.51
8 0.57
9 0.57
10 0.55
11 0.54
12 0.54
13 0.48
14 0.43
15 0.37
16 0.31
17 0.27
18 0.21
19 0.16
20 0.16
21 0.17
22 0.18
23 0.18
24 0.17
25 0.16
26 0.15
27 0.16
28 0.11
29 0.1
30 0.08
31 0.08
32 0.08
33 0.07
34 0.07
35 0.05
36 0.04
37 0.04
38 0.06
39 0.06
40 0.08
41 0.11
42 0.11
43 0.13
44 0.13
45 0.16
46 0.19
47 0.22
48 0.2
49 0.2
50 0.21
51 0.22
52 0.27
53 0.28
54 0.29
55 0.31
56 0.36
57 0.39
58 0.4
59 0.38
60 0.33
61 0.31
62 0.28
63 0.28
64 0.26
65 0.23
66 0.21
67 0.26
68 0.25
69 0.23
70 0.26
71 0.23
72 0.21
73 0.21
74 0.21
75 0.17
76 0.17
77 0.15
78 0.1
79 0.09
80 0.1
81 0.12
82 0.12
83 0.13
84 0.15
85 0.15
86 0.15
87 0.2
88 0.2
89 0.24
90 0.34
91 0.37
92 0.43
93 0.46
94 0.47
95 0.42
96 0.42
97 0.42
98 0.38
99 0.35
100 0.33
101 0.33
102 0.35
103 0.39
104 0.38
105 0.35
106 0.38
107 0.44
108 0.5
109 0.56
110 0.61
111 0.68
112 0.78
113 0.83
114 0.84
115 0.86
116 0.82
117 0.8
118 0.76
119 0.73
120 0.65
121 0.58
122 0.54
123 0.45
124 0.44
125 0.45
126 0.46
127 0.43
128 0.47
129 0.51
130 0.52
131 0.52
132 0.49
133 0.48