Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XQ69

Protein Details
Accession A0A4P9XQ69   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-30PKTRNTFCKGKECRKHTPHKVSQLKAHydrophilic
NLS Segment(s)
PositionSequence
32-33KR
39-47GERRYRRKQ
60-61KK
Subcellular Location(s) nucl 10.5, cyto_nucl 9.5, mito 9, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRNTFCKGKECRKHTPHKVSQLKAGKRSEFAQGERRYRRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKYKHQLPLKRCKHFELGGDKKTKVCSMDSDGRGGIGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.75
4 0.8
5 0.81
6 0.86
7 0.86
8 0.87
9 0.85
10 0.86
11 0.87
12 0.79
13 0.79
14 0.78
15 0.73
16 0.7
17 0.66
18 0.57
19 0.51
20 0.5
21 0.48
22 0.42
23 0.39
24 0.41
25 0.42
26 0.49
27 0.56
28 0.62
29 0.6
30 0.63
31 0.68
32 0.64
33 0.63
34 0.62
35 0.63
36 0.62
37 0.65
38 0.6
39 0.56
40 0.52
41 0.47
42 0.44
43 0.41
44 0.38
45 0.3
46 0.37
47 0.4
48 0.48
49 0.57
50 0.59
51 0.58
52 0.62
53 0.69
54 0.69
55 0.68
56 0.64
57 0.59
58 0.56
59 0.54
60 0.48
61 0.43
62 0.42
63 0.36
64 0.34
65 0.36
66 0.38
67 0.43
68 0.5
69 0.55
70 0.57
71 0.68
72 0.73
73 0.76
74 0.73
75 0.68
76 0.65
77 0.6
78 0.58
79 0.58
80 0.56
81 0.55
82 0.57
83 0.54
84 0.5
85 0.49
86 0.45
87 0.36
88 0.3
89 0.28
90 0.31
91 0.4
92 0.39
93 0.39
94 0.36
95 0.34
96 0.32
97 0.27
98 0.19