Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9XW21

Protein Details
Accession A0A4P9XW21    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPKIRRQRSRKPPAGFEDIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001748  BUD31  
IPR018230  BUD31/G10-rel_CS  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF01125  G10  
PROSITE View protein in PROSITE  
PS00997  G10_1  
PS00998  G10_2  
Amino Acid Sequences MPKIRRQRSRKPPAGFEDIEETLQEFQKKMRDVENEPHEGKRKAESIWPVFRLHHQRSRYVYELFFKRRAISRELYNYLLKEGYADANLIAKWKKPGFEKLCCLRCIQSRDTNFGTACVCRVPRSNLEEGKVVECVHCGCRGCSSTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.7
3 0.61
4 0.56
5 0.48
6 0.41
7 0.32
8 0.26
9 0.19
10 0.21
11 0.2
12 0.14
13 0.15
14 0.21
15 0.24
16 0.25
17 0.29
18 0.32
19 0.37
20 0.46
21 0.5
22 0.5
23 0.48
24 0.51
25 0.5
26 0.46
27 0.42
28 0.37
29 0.32
30 0.27
31 0.31
32 0.34
33 0.35
34 0.4
35 0.4
36 0.38
37 0.36
38 0.42
39 0.45
40 0.44
41 0.44
42 0.4
43 0.44
44 0.46
45 0.51
46 0.48
47 0.41
48 0.36
49 0.35
50 0.39
51 0.38
52 0.36
53 0.31
54 0.3
55 0.32
56 0.33
57 0.32
58 0.28
59 0.28
60 0.31
61 0.33
62 0.34
63 0.31
64 0.28
65 0.24
66 0.21
67 0.17
68 0.11
69 0.1
70 0.08
71 0.07
72 0.06
73 0.06
74 0.07
75 0.07
76 0.09
77 0.09
78 0.09
79 0.14
80 0.16
81 0.19
82 0.21
83 0.32
84 0.36
85 0.42
86 0.49
87 0.53
88 0.58
89 0.55
90 0.53
91 0.47
92 0.48
93 0.47
94 0.44
95 0.44
96 0.42
97 0.47
98 0.47
99 0.46
100 0.39
101 0.35
102 0.31
103 0.23
104 0.21
105 0.19
106 0.18
107 0.17
108 0.22
109 0.26
110 0.31
111 0.36
112 0.43
113 0.43
114 0.45
115 0.47
116 0.44
117 0.4
118 0.35
119 0.29
120 0.22
121 0.19
122 0.19
123 0.17
124 0.2
125 0.2
126 0.2
127 0.26