Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XGC1

Protein Details
Accession A0A4P9XGC1   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKPTREQRMAQRQRDREQAYHydrophilic
117-138GVSVARFARRRRRSRRDSATFAHydrophilic
NLS Segment(s)
PositionSequence
124-132ARRRRRSRR
Subcellular Location(s) mito 14.5, cyto_mito 10.5, cyto 5.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013922  Cyclin_PHO80-like  
Gene Ontology GO:0016020  C:membrane  
GO:0019901  F:protein kinase binding  
GO:0000079  P:regulation of cyclin-dependent protein serine/threonine kinase activity  
CDD cd20557  CYCLIN_ScPCL1-like  
Amino Acid Sequences MKPTREQRMAQRQRDREQAYWKLGVELADPLCEYRSFMETLRTHGVTSGELVRIPASLIDFTAWFATTMLDGPGCAGVTDEAALQRDTRFLAALLMHARLSCSTLLLALFYVTRLRGVSVARFARRRRRSRRDSATFANRQCVGEYDEGVTSKGVLAAKTAQHALSAGTPSDTSTGWSVPRLLLASLIVADKYLFDETYDNAQWNMFARACGNDRAHAGLDRTCVNALERQLLHDLDYRVHIRQDVYARFLDQIEAALTFWRLRCWSRGQIPSAKRST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.79
3 0.74
4 0.73
5 0.71
6 0.66
7 0.62
8 0.55
9 0.47
10 0.42
11 0.36
12 0.28
13 0.25
14 0.19
15 0.16
16 0.16
17 0.15
18 0.15
19 0.14
20 0.14
21 0.12
22 0.14
23 0.15
24 0.15
25 0.24
26 0.23
27 0.28
28 0.33
29 0.31
30 0.29
31 0.29
32 0.29
33 0.2
34 0.22
35 0.2
36 0.15
37 0.14
38 0.15
39 0.13
40 0.12
41 0.12
42 0.1
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.09
49 0.09
50 0.09
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.07
70 0.08
71 0.08
72 0.08
73 0.09
74 0.09
75 0.09
76 0.09
77 0.07
78 0.09
79 0.08
80 0.1
81 0.1
82 0.1
83 0.1
84 0.1
85 0.1
86 0.09
87 0.1
88 0.08
89 0.07
90 0.06
91 0.07
92 0.07
93 0.06
94 0.06
95 0.05
96 0.05
97 0.05
98 0.06
99 0.05
100 0.06
101 0.06
102 0.06
103 0.08
104 0.09
105 0.1
106 0.16
107 0.19
108 0.23
109 0.28
110 0.33
111 0.42
112 0.51
113 0.59
114 0.64
115 0.71
116 0.76
117 0.81
118 0.87
119 0.83
120 0.79
121 0.76
122 0.75
123 0.7
124 0.62
125 0.55
126 0.45
127 0.38
128 0.33
129 0.27
130 0.2
131 0.15
132 0.15
133 0.12
134 0.12
135 0.11
136 0.12
137 0.1
138 0.07
139 0.06
140 0.08
141 0.07
142 0.07
143 0.07
144 0.09
145 0.1
146 0.12
147 0.12
148 0.1
149 0.09
150 0.1
151 0.09
152 0.08
153 0.09
154 0.07
155 0.07
156 0.07
157 0.08
158 0.09
159 0.08
160 0.08
161 0.08
162 0.09
163 0.09
164 0.1
165 0.11
166 0.09
167 0.11
168 0.1
169 0.09
170 0.08
171 0.08
172 0.07
173 0.07
174 0.07
175 0.06
176 0.05
177 0.05
178 0.05
179 0.06
180 0.07
181 0.06
182 0.07
183 0.08
184 0.09
185 0.15
186 0.16
187 0.14
188 0.14
189 0.14
190 0.14
191 0.15
192 0.17
193 0.12
194 0.11
195 0.12
196 0.15
197 0.18
198 0.23
199 0.23
200 0.21
201 0.22
202 0.24
203 0.25
204 0.23
205 0.23
206 0.19
207 0.2
208 0.19
209 0.19
210 0.17
211 0.17
212 0.16
213 0.18
214 0.17
215 0.22
216 0.21
217 0.22
218 0.24
219 0.24
220 0.24
221 0.26
222 0.25
223 0.2
224 0.25
225 0.25
226 0.23
227 0.25
228 0.24
229 0.2
230 0.25
231 0.31
232 0.3
233 0.31
234 0.31
235 0.31
236 0.3
237 0.29
238 0.24
239 0.17
240 0.15
241 0.12
242 0.11
243 0.1
244 0.1
245 0.11
246 0.12
247 0.13
248 0.16
249 0.18
250 0.21
251 0.26
252 0.32
253 0.4
254 0.47
255 0.54
256 0.57
257 0.63
258 0.67