Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1XPN1

Protein Details
Accession K1XPN1   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-46QTPKVEPQEKKKTPKGRAKKRITYTRRFVNHydrophilic
NLS Segment(s)
PositionSequence
14-37VKSQTPKVEPQEKKKTPKGRAKKR
Subcellular Location(s) mito 15.5, mito_nucl 10.5, cyto 7, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mbe:MBM_07205  -  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKKKTPKGRAKKRITYTRRFVNVTLTGGKRKPIFGMEGGSGVCLFVAWTGTEMRLMHLGQIDARLWGGTLGMPLQRDGWRLCVYLTPETR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.49
4 0.5
5 0.53
6 0.62
7 0.64
8 0.69
9 0.7
10 0.72
11 0.75
12 0.76
13 0.79
14 0.79
15 0.8
16 0.79
17 0.83
18 0.84
19 0.84
20 0.87
21 0.88
22 0.89
23 0.89
24 0.89
25 0.87
26 0.85
27 0.8
28 0.78
29 0.73
30 0.65
31 0.56
32 0.51
33 0.45
34 0.38
35 0.35
36 0.28
37 0.27
38 0.26
39 0.28
40 0.23
41 0.21
42 0.2
43 0.16
44 0.17
45 0.14
46 0.15
47 0.13
48 0.13
49 0.12
50 0.11
51 0.09
52 0.07
53 0.06
54 0.04
55 0.03
56 0.02
57 0.03
58 0.03
59 0.04
60 0.05
61 0.05
62 0.08
63 0.08
64 0.09
65 0.1
66 0.1
67 0.11
68 0.11
69 0.12
70 0.1
71 0.12
72 0.11
73 0.09
74 0.1
75 0.08
76 0.07
77 0.07
78 0.07
79 0.05
80 0.05
81 0.07
82 0.08
83 0.09
84 0.1
85 0.13
86 0.15
87 0.18
88 0.18
89 0.22
90 0.23
91 0.23
92 0.24
93 0.25
94 0.28