Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XWV9

Protein Details
Accession A0A4P9XWV9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20DEPHFKRKRQILRDHPEIAEBasic
NLS Segment(s)
Subcellular Location(s) plas 21, mito 3, cyto 1, pero 1, E.R. 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR005804  FA_desaturase_dom  
IPR013866  Sphingolipid_d4-desaturase_N  
Gene Ontology GO:0016020  C:membrane  
GO:0006629  P:lipid metabolic process  
Pfam View protein in Pfam  
PF00487  FA_desaturase  
PF08557  Lipid_DES  
Amino Acid Sequences DEPHFKRKRQILRDHPEIAEMYGYDINTFYTTVAGAILQVSLAFLFGRVLTDYNWSMFACAYVVGGSVTSLFGVILHECTHNLAAASPAMNRLCGLIANVGIPVPIAMSFRRYHLEHHTYQGVEGRDPDLPMEWEVRLIHGNPLTKLCWIMIYPVMYVVRGAALGKPMSTWEKYNWAWTICTDLIIYWTCGLRGLLYLLASLWLGYSLHPGAVHFIQEHYTFVDGQETYSYYGSGNKVFMNIGYHNEHHDFAKIPCSRLPEVRATAPEYYDTLAYHTSWMMVLWRFIVDPSFGAISRVYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.72
3 0.64
4 0.55
5 0.44
6 0.35
7 0.25
8 0.2
9 0.16
10 0.16
11 0.13
12 0.12
13 0.12
14 0.12
15 0.12
16 0.09
17 0.07
18 0.08
19 0.07
20 0.07
21 0.06
22 0.06
23 0.06
24 0.05
25 0.05
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.05
33 0.05
34 0.06
35 0.07
36 0.08
37 0.08
38 0.13
39 0.14
40 0.14
41 0.16
42 0.14
43 0.14
44 0.13
45 0.13
46 0.09
47 0.08
48 0.07
49 0.05
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.06
63 0.07
64 0.08
65 0.08
66 0.1
67 0.1
68 0.09
69 0.09
70 0.08
71 0.08
72 0.08
73 0.09
74 0.08
75 0.11
76 0.11
77 0.11
78 0.11
79 0.1
80 0.1
81 0.09
82 0.1
83 0.07
84 0.07
85 0.07
86 0.07
87 0.06
88 0.06
89 0.05
90 0.04
91 0.04
92 0.04
93 0.05
94 0.05
95 0.09
96 0.09
97 0.11
98 0.15
99 0.16
100 0.19
101 0.26
102 0.32
103 0.31
104 0.33
105 0.34
106 0.31
107 0.3
108 0.31
109 0.23
110 0.18
111 0.17
112 0.15
113 0.13
114 0.13
115 0.13
116 0.09
117 0.09
118 0.09
119 0.1
120 0.08
121 0.09
122 0.09
123 0.1
124 0.1
125 0.1
126 0.11
127 0.12
128 0.14
129 0.13
130 0.15
131 0.14
132 0.14
133 0.13
134 0.11
135 0.09
136 0.08
137 0.09
138 0.09
139 0.09
140 0.09
141 0.1
142 0.1
143 0.09
144 0.09
145 0.07
146 0.05
147 0.05
148 0.05
149 0.04
150 0.06
151 0.06
152 0.06
153 0.06
154 0.08
155 0.11
156 0.11
157 0.13
158 0.12
159 0.19
160 0.19
161 0.23
162 0.24
163 0.22
164 0.21
165 0.2
166 0.24
167 0.17
168 0.17
169 0.14
170 0.11
171 0.12
172 0.13
173 0.13
174 0.09
175 0.09
176 0.08
177 0.09
178 0.09
179 0.07
180 0.06
181 0.07
182 0.07
183 0.07
184 0.07
185 0.06
186 0.06
187 0.06
188 0.05
189 0.04
190 0.04
191 0.04
192 0.04
193 0.07
194 0.07
195 0.07
196 0.07
197 0.08
198 0.1
199 0.11
200 0.11
201 0.09
202 0.1
203 0.12
204 0.12
205 0.13
206 0.11
207 0.11
208 0.11
209 0.1
210 0.14
211 0.11
212 0.11
213 0.12
214 0.12
215 0.13
216 0.13
217 0.13
218 0.09
219 0.13
220 0.14
221 0.15
222 0.15
223 0.14
224 0.14
225 0.14
226 0.15
227 0.15
228 0.15
229 0.18
230 0.2
231 0.21
232 0.24
233 0.26
234 0.26
235 0.23
236 0.24
237 0.22
238 0.19
239 0.27
240 0.26
241 0.26
242 0.28
243 0.33
244 0.35
245 0.38
246 0.41
247 0.39
248 0.41
249 0.43
250 0.43
251 0.41
252 0.39
253 0.35
254 0.32
255 0.26
256 0.23
257 0.19
258 0.16
259 0.15
260 0.15
261 0.14
262 0.14
263 0.13
264 0.12
265 0.11
266 0.11
267 0.13
268 0.13
269 0.13
270 0.13
271 0.13
272 0.13
273 0.14
274 0.15
275 0.12
276 0.11
277 0.13
278 0.14
279 0.14
280 0.15