FuNGI

A0A4P9XLS8

Protein Details

Accession

A0A4P9XLS8

Localization Confidence

Medium

Confidence Score

11.3

NoLS Segment(s)

Position	Sequence	Protein Nature
53-80	FPERIVRAVARYRKKRKWGTQLRCQLFI	Hydrophilic

NLS Segment(s)

Position	Sequence
65-68	RKKR

Subcellular Location(s)

nucl 9, cyto 9, cyto_nucl 9

Family & Domain DBs

InterPro	View protein in InterPro IPR018606 Arb1
Gene Ontology	GO:0033167 C:ARC complex GO:0031047 P:RNA-mediated gene silencing
Pfam	View protein in Pfam PF09692 Arb1

Amino Acid Sequences

MADTTSAPSASNSDGAAAPTANDIAAAAASLARLTVQPNSADQPHRFDPEMPFPERIVRAVARYRKKRKWGTQLRCQLFISYMRVGEIDIGSKSHIPGDHPEDDEVYDDCDGYDDQEGYEDPEDEGEEALVKRQEKNFAPQSKRQRELARAELNELGALPQLDEDEDELEVDFVGCVRQFLSTYLMRDSYYYHINAFVEAPGVVQRFLEWLQMHNVCPEYTADIRASLLVCQRASMELPRCKRAISKMPGNFNTLCAAKYGGQLYHAYGGSEDGGASWTDDETQRTFGLTCEQVRMVTDDAFGPVTRVQHSRRTLEVVRVEPFDPSRQHESAGDANAASLPRVGVPHGKIWLREHQAVGHRPGEPWTLGTRAAAAKADDGGDDEDDASLICLHLDPTPANEMLPGMVMTADYHQLSNGLWYVDTIVNLWPSYYLDAQEDEYEEDSEEDFDDNGAWEY

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.15
2	0.15
3	0.16
4	0.13
5	0.12
6	0.11
7	0.12
8	0.09
9	0.08
10	0.07
11	0.06
12	0.06
13	0.05
14	0.04
15	0.04
16	0.05
17	0.05
18	0.04
19	0.05
20	0.06
21	0.08
22	0.11
23	0.14
24	0.15
25	0.18
26	0.23
27	0.28
28	0.34
29	0.34
30	0.38
31	0.4
32	0.43
33	0.42
34	0.41
35	0.42
36	0.46
37	0.5
38	0.46
39	0.43
40	0.4
41	0.44
42	0.42
43	0.37
44	0.31
45	0.27
46	0.29
47	0.36
48	0.44
49	0.49
50	0.58
51	0.68
52	0.72
53	0.81
54	0.86
55	0.87
56	0.89
57	0.9
58	0.89
59	0.89
60	0.91
61	0.85
62	0.78
63	0.68
64	0.58
65	0.5
66	0.44
67	0.38
68	0.29
69	0.25
70	0.21
71	0.2
72	0.19
73	0.18
74	0.15
75	0.12
76	0.1
77	0.1
78	0.11
79	0.12
80	0.12
81	0.13
82	0.14
83	0.14
84	0.19
85	0.26
86	0.29
87	0.29
88	0.3
89	0.28
90	0.27
91	0.26
92	0.21
93	0.15
94	0.11
95	0.1
96	0.09
97	0.09
98	0.09
99	0.08
100	0.1
101	0.08
102	0.08
103	0.09
104	0.09
105	0.1
106	0.11
107	0.11
108	0.09
109	0.09
110	0.1
111	0.09
112	0.09
113	0.06
114	0.07
115	0.07
116	0.09
117	0.12
118	0.13
119	0.17
120	0.19
121	0.26
122	0.27
123	0.35
124	0.42
125	0.48
126	0.53
127	0.58
128	0.67
129	0.69
130	0.7
131	0.68
132	0.64
133	0.62
134	0.63
135	0.63
136	0.59
137	0.51
138	0.49
139	0.44
140	0.38
141	0.31
142	0.24
143	0.16
144	0.09
145	0.08
146	0.06
147	0.05
148	0.05
149	0.05
150	0.05
151	0.05
152	0.05
153	0.05
154	0.05
155	0.05
156	0.05
157	0.05
158	0.04
159	0.04
160	0.03
161	0.04
162	0.04
163	0.04
164	0.04
165	0.05
166	0.05
167	0.07
168	0.11
169	0.12
170	0.14
171	0.15
172	0.16
173	0.15
174	0.15
175	0.16
176	0.14
177	0.15
178	0.14
179	0.13
180	0.14
181	0.14
182	0.14
183	0.13
184	0.1
185	0.08
186	0.07
187	0.07
188	0.07
189	0.08
190	0.07
191	0.06
192	0.06
193	0.07
194	0.08
195	0.11
196	0.1
197	0.1
198	0.15
199	0.16
200	0.16
201	0.16
202	0.17
203	0.13
204	0.13
205	0.12
206	0.11
207	0.1
208	0.11
209	0.1
210	0.1
211	0.1
212	0.1
213	0.1
214	0.08
215	0.1
216	0.1
217	0.1
218	0.1
219	0.1
220	0.1
221	0.11
222	0.14
223	0.19
224	0.24
225	0.26
226	0.29
227	0.29
228	0.29
229	0.31
230	0.33
231	0.35
232	0.35
233	0.42
234	0.44
235	0.51
236	0.52
237	0.54
238	0.47
239	0.39
240	0.35
241	0.26
242	0.21
243	0.14
244	0.14
245	0.11
246	0.13
247	0.14
248	0.11
249	0.12
250	0.13
251	0.13
252	0.14
253	0.13
254	0.11
255	0.1
256	0.1
257	0.09
258	0.08
259	0.07
260	0.04
261	0.05
262	0.05
263	0.05
264	0.05
265	0.04
266	0.06
267	0.07
268	0.09
269	0.09
270	0.11
271	0.11
272	0.11
273	0.11
274	0.11
275	0.14
276	0.15
277	0.15
278	0.15
279	0.16
280	0.15
281	0.16
282	0.17
283	0.14
284	0.12
285	0.11
286	0.1
287	0.1
288	0.11
289	0.1
290	0.09
291	0.09
292	0.1
293	0.13
294	0.17
295	0.19
296	0.27
297	0.31
298	0.33
299	0.33
300	0.38
301	0.38
302	0.4
303	0.42
304	0.37
305	0.35
306	0.34
307	0.32
308	0.28
309	0.28
310	0.26
311	0.23
312	0.25
313	0.3
314	0.28
315	0.29
316	0.28
317	0.3
318	0.29
319	0.29
320	0.24
321	0.17
322	0.16
323	0.17
324	0.16
325	0.12
326	0.08
327	0.07
328	0.07
329	0.08
330	0.09
331	0.13
332	0.15
333	0.18
334	0.23
335	0.25
336	0.26
337	0.3
338	0.37
339	0.38
340	0.39
341	0.37
342	0.37
343	0.43
344	0.45
345	0.46
346	0.4
347	0.35
348	0.33
349	0.35
350	0.32
351	0.25
352	0.22
353	0.2
354	0.19
355	0.18
356	0.18
357	0.18
358	0.16
359	0.17
360	0.16
361	0.14
362	0.13
363	0.14
364	0.14
365	0.11
366	0.11
367	0.11
368	0.1
369	0.1
370	0.09
371	0.08
372	0.08
373	0.08
374	0.07
375	0.05
376	0.05
377	0.05
378	0.05
379	0.06
380	0.07
381	0.1
382	0.09
383	0.12
384	0.16
385	0.16
386	0.16
387	0.15
388	0.14
389	0.12
390	0.13
391	0.1
392	0.06
393	0.06
394	0.06
395	0.07
396	0.08
397	0.11
398	0.1
399	0.11
400	0.1
401	0.11
402	0.11
403	0.13
404	0.13
405	0.11
406	0.1
407	0.1
408	0.14
409	0.14
410	0.15
411	0.13
412	0.14
413	0.15
414	0.15
415	0.15
416	0.12
417	0.13
418	0.16
419	0.16
420	0.15
421	0.15
422	0.17
423	0.19
424	0.19
425	0.2
426	0.18
427	0.18
428	0.17
429	0.16
430	0.15
431	0.14
432	0.13
433	0.12
434	0.11
435	0.1
436	0.09
437	0.09

A0A4P9XLS8

3D AlphaFold-predicted Structure Viewer