Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XRS9

Protein Details
Accession A0A4P9XRS9   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
126-150LAAERLKRDKKVRQEQREQENKQVGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 11.333, cyto 7.5, cyto_pero 6.166, pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039730  Jlp2/Ccd25  
IPR008532  NFACT_RNA-bd  
Pfam View protein in Pfam  
PF05670  NFACT-R_1  
Amino Acid Sequences MGKDKYENEDLIKHGWDEDVWFHVDKLSSAHVYLRMQRGQAWDQMPDELLIDCAQLVKANSIEGNKMSNIGIVYTPWSNLKKTGDMATGQVSFHNNKLVRRMRVEKRINEIVNRINKTKQELYPDLAAERLKRDKKVRQEQREQENKQVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.16
4 0.14
5 0.14
6 0.14
7 0.15
8 0.15
9 0.15
10 0.16
11 0.16
12 0.14
13 0.15
14 0.16
15 0.14
16 0.14
17 0.16
18 0.18
19 0.2
20 0.25
21 0.28
22 0.27
23 0.27
24 0.28
25 0.32
26 0.3
27 0.34
28 0.3
29 0.26
30 0.24
31 0.24
32 0.22
33 0.17
34 0.15
35 0.09
36 0.09
37 0.07
38 0.06
39 0.05
40 0.05
41 0.05
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.08
48 0.09
49 0.1
50 0.09
51 0.1
52 0.09
53 0.1
54 0.09
55 0.09
56 0.08
57 0.08
58 0.07
59 0.06
60 0.08
61 0.07
62 0.07
63 0.1
64 0.11
65 0.11
66 0.14
67 0.15
68 0.15
69 0.17
70 0.18
71 0.17
72 0.16
73 0.17
74 0.17
75 0.16
76 0.14
77 0.14
78 0.14
79 0.13
80 0.13
81 0.19
82 0.18
83 0.19
84 0.28
85 0.34
86 0.36
87 0.42
88 0.5
89 0.51
90 0.6
91 0.67
92 0.62
93 0.63
94 0.67
95 0.62
96 0.56
97 0.53
98 0.5
99 0.5
100 0.49
101 0.44
102 0.4
103 0.4
104 0.45
105 0.47
106 0.43
107 0.43
108 0.43
109 0.44
110 0.44
111 0.42
112 0.36
113 0.32
114 0.3
115 0.23
116 0.26
117 0.32
118 0.33
119 0.4
120 0.48
121 0.55
122 0.64
123 0.74
124 0.78
125 0.79
126 0.86
127 0.87
128 0.9
129 0.91
130 0.85