Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C4R401

Protein Details
Accession C4R401    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-31SESRRPHSSAPKQTKSRSHIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Gene Ontology GO:0033698  C:Rpd3L complex  
GO:0003714  F:transcription corepressor activity  
GO:0061188  P:negative regulation of rDNA heterochromatin formation  
GO:0061186  P:negative regulation of silent mating-type cassette heterochromatin formation  
GO:0016479  P:negative regulation of transcription by RNA polymerase I  
GO:2000219  P:positive regulation of invasive growth in response to glucose limitation  
GO:0061408  P:positive regulation of transcription from RNA polymerase II promoter in response to heat stress  
KEGG ppa:PAS_chr3_0250  -  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MPPRRDASASESESRRPHSSAPKQTKSRSHITQQVQKEFVAKYVNSNGPNDRILPDPLDFNEYPTSNLRNYARKLIKNEQIPDCKTVFGSMLESKIGEESFSYKKNHAPNTYRISKPQLASIVHQHFVSHLPVKESDTITNFIYKVKNQDKSFKLNIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.4
4 0.42
5 0.46
6 0.54
7 0.59
8 0.66
9 0.7
10 0.74
11 0.79
12 0.82
13 0.77
14 0.75
15 0.7
16 0.67
17 0.66
18 0.67
19 0.68
20 0.67
21 0.67
22 0.6
23 0.53
24 0.5
25 0.41
26 0.35
27 0.31
28 0.23
29 0.21
30 0.26
31 0.3
32 0.29
33 0.31
34 0.3
35 0.28
36 0.29
37 0.26
38 0.21
39 0.19
40 0.19
41 0.18
42 0.16
43 0.15
44 0.15
45 0.2
46 0.18
47 0.18
48 0.2
49 0.18
50 0.2
51 0.2
52 0.22
53 0.16
54 0.21
55 0.21
56 0.24
57 0.26
58 0.33
59 0.37
60 0.38
61 0.44
62 0.47
63 0.5
64 0.49
65 0.52
66 0.49
67 0.49
68 0.46
69 0.43
70 0.36
71 0.31
72 0.25
73 0.21
74 0.16
75 0.11
76 0.12
77 0.1
78 0.11
79 0.1
80 0.1
81 0.1
82 0.1
83 0.09
84 0.06
85 0.06
86 0.09
87 0.12
88 0.16
89 0.18
90 0.18
91 0.23
92 0.3
93 0.37
94 0.41
95 0.43
96 0.47
97 0.54
98 0.6
99 0.56
100 0.53
101 0.54
102 0.51
103 0.46
104 0.43
105 0.4
106 0.34
107 0.35
108 0.41
109 0.38
110 0.34
111 0.33
112 0.29
113 0.24
114 0.25
115 0.26
116 0.23
117 0.2
118 0.21
119 0.23
120 0.25
121 0.29
122 0.29
123 0.28
124 0.26
125 0.27
126 0.25
127 0.27
128 0.25
129 0.24
130 0.26
131 0.25
132 0.32
133 0.38
134 0.46
135 0.48
136 0.57
137 0.59
138 0.63