Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XTQ6

Protein Details
Accession A0A4P9XTQ6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-27STSAITFKLHRHRRHLPPLPTAPQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR004789  Acetalactate_synth_ssu  
IPR027271  Acetolactate_synth/TF_NikR_C  
IPR019455  Acetolactate_synth_ssu_C  
IPR045865  ACT-like_dom_sf  
IPR002912  ACT_dom  
IPR039557  AHAS_ACT  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990610  F:acetolactate synthase regulator activity  
GO:0009097  P:isoleucine biosynthetic process  
GO:0009099  P:valine biosynthetic process  
Pfam View protein in Pfam  
PF01842  ACT  
PF10369  ALS_ss_C  
PROSITE View protein in PROSITE  
PS51671  ACT  
CDD cd04878  ACT_AHAS  
Amino Acid Sequences SASSTSAITFKLHRHRRHLPPLPTAPQPTAEEAVTNILYNTPDSSTQPSQRRVLSCLVQDEPGVLSRVSGILAGRGFNIESLVVSKTEVRDLSRMTIIVKGQEAVVEQARRQLEDLVPVWAVIDYTGARLVERELLLVKVSTLGPEQELERQRQLQRAAAGDLTAQEAEASHRENQASTKLPPPSVMLRETQDNLRALSELANLFRGRVVDVSAGSVVLELCAKSNRIEAFVKLIQPFGILEAARSGVMAMPRAYMPGQEDADANAPTASEPTVDATMLPPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.66
3 0.74
4 0.82
5 0.84
6 0.81
7 0.81
8 0.82
9 0.78
10 0.74
11 0.68
12 0.58
13 0.53
14 0.47
15 0.41
16 0.35
17 0.3
18 0.24
19 0.21
20 0.22
21 0.18
22 0.16
23 0.12
24 0.11
25 0.12
26 0.12
27 0.13
28 0.11
29 0.12
30 0.14
31 0.21
32 0.26
33 0.34
34 0.4
35 0.44
36 0.47
37 0.51
38 0.51
39 0.48
40 0.47
41 0.43
42 0.39
43 0.38
44 0.35
45 0.3
46 0.28
47 0.25
48 0.2
49 0.17
50 0.16
51 0.11
52 0.09
53 0.09
54 0.09
55 0.09
56 0.08
57 0.07
58 0.08
59 0.09
60 0.09
61 0.09
62 0.09
63 0.09
64 0.08
65 0.09
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.08
72 0.09
73 0.09
74 0.12
75 0.13
76 0.13
77 0.15
78 0.16
79 0.18
80 0.18
81 0.17
82 0.15
83 0.17
84 0.16
85 0.15
86 0.14
87 0.12
88 0.1
89 0.1
90 0.1
91 0.09
92 0.12
93 0.12
94 0.11
95 0.16
96 0.16
97 0.16
98 0.17
99 0.17
100 0.14
101 0.17
102 0.17
103 0.14
104 0.13
105 0.13
106 0.12
107 0.1
108 0.09
109 0.05
110 0.05
111 0.04
112 0.04
113 0.06
114 0.05
115 0.05
116 0.06
117 0.06
118 0.08
119 0.08
120 0.08
121 0.07
122 0.07
123 0.08
124 0.07
125 0.07
126 0.06
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.07
133 0.07
134 0.12
135 0.15
136 0.17
137 0.18
138 0.23
139 0.24
140 0.28
141 0.29
142 0.26
143 0.25
144 0.25
145 0.24
146 0.19
147 0.17
148 0.13
149 0.12
150 0.09
151 0.07
152 0.06
153 0.04
154 0.05
155 0.06
156 0.07
157 0.09
158 0.09
159 0.11
160 0.12
161 0.12
162 0.14
163 0.17
164 0.19
165 0.19
166 0.23
167 0.23
168 0.24
169 0.24
170 0.26
171 0.26
172 0.26
173 0.25
174 0.22
175 0.22
176 0.24
177 0.25
178 0.24
179 0.24
180 0.22
181 0.21
182 0.19
183 0.17
184 0.15
185 0.14
186 0.14
187 0.11
188 0.11
189 0.13
190 0.13
191 0.13
192 0.13
193 0.12
194 0.11
195 0.1
196 0.11
197 0.09
198 0.1
199 0.11
200 0.1
201 0.09
202 0.08
203 0.08
204 0.07
205 0.06
206 0.06
207 0.05
208 0.06
209 0.08
210 0.09
211 0.1
212 0.15
213 0.15
214 0.19
215 0.21
216 0.2
217 0.25
218 0.27
219 0.3
220 0.26
221 0.26
222 0.22
223 0.21
224 0.2
225 0.14
226 0.15
227 0.1
228 0.1
229 0.11
230 0.11
231 0.11
232 0.1
233 0.09
234 0.08
235 0.1
236 0.12
237 0.11
238 0.12
239 0.12
240 0.14
241 0.14
242 0.14
243 0.15
244 0.19
245 0.19
246 0.19
247 0.19
248 0.19
249 0.23
250 0.21
251 0.19
252 0.13
253 0.12
254 0.12
255 0.12
256 0.1
257 0.07
258 0.08
259 0.11
260 0.12
261 0.12
262 0.12