Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9XK70

Protein Details
Accession A0A4P9XK70    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
71-95FSDRNRQHIKNKYKREEQHSPQRINHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 8, mito 2, extr 1, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
IPR039467  TFIIIB_B''_Myb  
Pfam View protein in Pfam  
PF15963  Myb_DNA-bind_7  
CDD cd00167  SANT  
Amino Acid Sequences EDSLVVQHADLHGGPTLPLERVEESQYTRFVTSATFGKRNRMVKWNTEQTQLFYEGLVKFGTDFEMIATLFSDRNRQHIKNKYKREEQHSPQRINDALIHRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.12
4 0.11
5 0.11
6 0.12
7 0.13
8 0.15
9 0.18
10 0.18
11 0.21
12 0.22
13 0.23
14 0.22
15 0.21
16 0.19
17 0.16
18 0.14
19 0.13
20 0.16
21 0.19
22 0.24
23 0.25
24 0.31
25 0.37
26 0.41
27 0.42
28 0.45
29 0.43
30 0.43
31 0.51
32 0.53
33 0.49
34 0.49
35 0.46
36 0.39
37 0.38
38 0.33
39 0.25
40 0.16
41 0.17
42 0.13
43 0.13
44 0.11
45 0.09
46 0.07
47 0.08
48 0.09
49 0.06
50 0.06
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.08
59 0.15
60 0.14
61 0.22
62 0.29
63 0.33
64 0.41
65 0.51
66 0.62
67 0.65
68 0.76
69 0.77
70 0.8
71 0.84
72 0.84
73 0.85
74 0.82
75 0.83
76 0.82
77 0.78
78 0.7
79 0.67
80 0.59
81 0.52
82 0.49