Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9XU41

Protein Details
Accession A0A4P9XU41    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
8-27SGVSQAKRPRRRPEEIERLYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences TVTFVNSSGVSQAKRPRRRPEEIERLYTCDYPGCTKAYGTLNHLNAHVAMQQHGGKRLPFEFEALRRTRRQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.64
4 0.68
5 0.76
6 0.78
7 0.8
8 0.81
9 0.76
10 0.75
11 0.65
12 0.62
13 0.56
14 0.48
15 0.37
16 0.27
17 0.23
18 0.18
19 0.19
20 0.16
21 0.14
22 0.13
23 0.16
24 0.19
25 0.19
26 0.22
27 0.26
28 0.26
29 0.27
30 0.27
31 0.23
32 0.2
33 0.19
34 0.16
35 0.11
36 0.1
37 0.12
38 0.15
39 0.16
40 0.2
41 0.21
42 0.2
43 0.23
44 0.23
45 0.25
46 0.22
47 0.24
48 0.27
49 0.29
50 0.36
51 0.38
52 0.43