Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9XKL9

Protein Details
Accession A0A4P9XKL9    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
58-80ELLKNGKDKRARKLAKKRVGDAGBasic
NLS Segment(s)
PositionSequence
61-76KNGKDKRARKLAKKRV
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences TTKTNIIIGKNKGFPTTPRTVKPRPASNKGRLGSRTKFVRELIREVAGFAPYERRVMELLKNGKDKRARKLAKKRVGDAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.42
4 0.42
5 0.43
6 0.49
7 0.53
8 0.6
9 0.65
10 0.67
11 0.66
12 0.7
13 0.71
14 0.71
15 0.75
16 0.67
17 0.65
18 0.59
19 0.57
20 0.51
21 0.49
22 0.46
23 0.39
24 0.4
25 0.37
26 0.39
27 0.35
28 0.35
29 0.31
30 0.27
31 0.25
32 0.23
33 0.22
34 0.16
35 0.14
36 0.1
37 0.12
38 0.11
39 0.12
40 0.12
41 0.12
42 0.13
43 0.15
44 0.19
45 0.23
46 0.29
47 0.34
48 0.42
49 0.42
50 0.48
51 0.55
52 0.56
53 0.57
54 0.62
55 0.65
56 0.68
57 0.79
58 0.82
59 0.84
60 0.86