Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XKW4

Protein Details
Accession A0A4P9XKW4    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-22QCNEKPFKYRCPRCGWRTCSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 7.5, cyto_nucl 6.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007529  Znf_HIT  
Pfam View protein in Pfam  
PF04438  zf-HIT  
PROSITE View protein in PROSITE  
PS51083  ZF_HIT  
Amino Acid Sequences CQQCNEKPFKYRCPRCGWRTCSLPCSRTHKQATGCSGQRDRTKYVPMKQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.83
4 0.78
5 0.73
6 0.72
7 0.67
8 0.64
9 0.6
10 0.53
11 0.48
12 0.51
13 0.48
14 0.49
15 0.5
16 0.48
17 0.48
18 0.51
19 0.52
20 0.51
21 0.51
22 0.49
23 0.49
24 0.5
25 0.52
26 0.51
27 0.51
28 0.48
29 0.54
30 0.55