Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XJ27

Protein Details
Accession A0A4P9XJ27   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
83-106AMPTLKRRTVARRRQRRMHAESSVHydrophilic
NLS Segment(s)
PositionSequence
93-97ARRRQ
Subcellular Location(s) cyto 9, nucl 8, mito 8, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR029060  PIN-like_dom_sf  
IPR006084  XPG/Rad2  
IPR019974  XPG_CS  
IPR006085  XPG_DNA_repair_N  
Gene Ontology GO:0004518  F:nuclease activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF00752  XPG_N  
PROSITE View protein in PROSITE  
PS00841  XPG_1  
CDD cd09868  PIN_XPG_RAD2  
Amino Acid Sequences MGVKELWPLLQPAGRKVNIEALRGKRLAVDILYRVVIWLHQFLKAMRDEEGKPLANAHLLGFFRRICKLLHNGIKPVFVFDGAMPTLKRRTVARRRQRRMHAESSVQRTAKRLLAMQMRTHALNAVSSRCVPVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.3
4 0.37
5 0.38
6 0.39
7 0.41
8 0.38
9 0.43
10 0.42
11 0.4
12 0.32
13 0.29
14 0.27
15 0.21
16 0.19
17 0.15
18 0.16
19 0.17
20 0.15
21 0.14
22 0.12
23 0.11
24 0.1
25 0.12
26 0.11
27 0.12
28 0.14
29 0.14
30 0.18
31 0.19
32 0.18
33 0.16
34 0.19
35 0.18
36 0.21
37 0.25
38 0.21
39 0.19
40 0.19
41 0.18
42 0.15
43 0.14
44 0.11
45 0.11
46 0.1
47 0.11
48 0.12
49 0.12
50 0.13
51 0.14
52 0.14
53 0.11
54 0.14
55 0.18
56 0.24
57 0.31
58 0.31
59 0.33
60 0.33
61 0.34
62 0.31
63 0.28
64 0.2
65 0.13
66 0.12
67 0.08
68 0.1
69 0.09
70 0.1
71 0.09
72 0.11
73 0.13
74 0.13
75 0.15
76 0.16
77 0.27
78 0.36
79 0.47
80 0.56
81 0.66
82 0.74
83 0.82
84 0.88
85 0.87
86 0.84
87 0.81
88 0.76
89 0.73
90 0.72
91 0.7
92 0.66
93 0.58
94 0.51
95 0.46
96 0.43
97 0.38
98 0.33
99 0.28
100 0.28
101 0.35
102 0.39
103 0.39
104 0.4
105 0.39
106 0.38
107 0.36
108 0.31
109 0.23
110 0.23
111 0.22
112 0.2
113 0.21
114 0.21